KEGG   Mus musculus (house mouse): 94332
Entry
94332             CDS       T01002                                 
Symbol
Cadm3, BIgR, Igsf4b, Necl-1, Necl1, SynCAM3, Tsll1
Name
(RefSeq) cell adhesion molecule 3
  KO
K06780  cell adhesion molecule 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    94332 (Cadm3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    94332 (Cadm3)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Necl family
   94332 (Cadm3)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig C2-set_2 V-set C1-set Izumo-Ig Ig_4 Syndecan
Other DBs
NCBI-GeneID: 94332
NCBI-ProteinID: NP_444429
MGI: 2137858
Ensembl: ENSMUSG00000005338
UniProt: Q99N28
Structure
LinkDB
Position
1:complement(173159459..173195705)
AA seq 396 aa
MGAPSALPLLLLLACSWAPGGANLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQW
SNPAQQTLYFGEKRALRDNRIQLVSSTPHELSISISNVALADEGEYTCSIFTMPVRTAKS
LVTVLGIPQKPIITGYKSSLREKETATLNCQSSGSKPAAQLTWRKGDQELHGDQTRIQED
PNGKTFTVSSSVSFQVTREDDGANIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPEPA
HPREGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMTQESALIFPFLNKSDSGTYGCTAT
SNMGSYTAYFTLNVNDPSPVPSSSSTYHAIIGGIVAFIVFLLLILLIFLGHYLIRHKGTY
LTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYFI
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgggggccccttccgccctgcccctgctcctgctcctcgcctgctcctgggcgcccggc
ggggccaatctttcccaggacgatagccagccctggacatctgatgaaacagttgtggct
ggtggcacagtggttctcaagtgtcaagtaaaagaccatgaagactcatctctgcagtgg
tctaaccctgctcagcagaccctatacttcggggagaagagagcccttcgagataatcgg
attcagctggttagctctactccccatgagctcagcatcagcatcagcaatgtggcgctg
gccgatgagggggagtacacgtgctccatcttcactatgcctgtgcgaaccgccaagtcc
cttgtcactgtgctcggaatcccacagaaacccataatcactggttataagtcatcattg
cgggaaaaggagacagccactctaaattgtcagtcttctgggagcaaacctgcagcccag
ctcacctggaggaaaggtgaccaagaactccacggggaccaaacacgaatccaggaagat
cccaacgggaaaaccttcactgtgagcagctcagtgtcattccaggttacccgggaggat
gatggagcaaacatcgtgtgctctgtgaaccatgaatctctgaagggagccgacagatcc
acttctcagcgcattgaagtgttatacacaccaacagccatgattaggccagaacctgct
catcctcgagaaggccagaagctgttgttacattgtgaggggcgtggcaatccagtcccc
cagcagtacgtgtgggtaaaggaaggcagtgagccacccctcaagatgacccaagagagt
gctctcatcttcccctttttgaataagagtgacagtggcacttatggctgtacagccaca
agcaacatgggcagctatacagcctacttcaccctcaatgtcaacgaccccagtccagtg
ccctcgtcctccagtacctaccacgccatcattggagggattgtggctttcattgtcttc
ctgctgctcattctgctcattttccttggacactatttgatccggcacaaaggaacctac
ctgacacacgaagcgaagggttccgacgatgctccagatgcggatacggccatcatcaac
gcagaaggcgggcagtcaggcggggatgacaagaaggaatatttcatctag

DBGET integrated database retrieval system