Microcebus murinus (gray mouse lemur): 105863998 Help Entry 105863998         CDS       T07238                                  Name (RefSeq) glutathione S-transferase Mu 2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur00480   Glutathione metabolism mmur00980   Metabolism of xenobiotics by cytochrome P450 mmur00982   Drug metabolism - cytochrome P450 mmur00983   Drug metabolism - other enzymes mmur01100   Metabolic pathways mmur01524   Platinum drug resistance mmur05200   Pathways in cancer mmur05204   Chemical carcinogenesis - DNA adducts mmur05207   Chemical carcinogenesis - receptor activation mmur05208   Chemical carcinogenesis - reactive oxygen species mmur05225   Hepatocellular carcinoma mmur05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     105863998   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     105863998    00982 Drug metabolism - cytochrome P450     105863998    00983 Drug metabolism - other enzymes     105863998  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105863998    05204 Chemical carcinogenesis - DNA adducts     105863998    05207 Chemical carcinogenesis - receptor activation     105863998    05208 Chemical carcinogenesis - reactive oxygen species     105863998   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105863998   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105863998   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105863998  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mmur02000]     105863998 Enzymes [BR:mmur01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      105863998 Transporters [BR:mmur02000]  Other transporters   Pores ion channels [TC:1]    105863998 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_C_6 GST_N_3 GST_N_2 GST_C_2 Motif Other DBs NCBI-GeneID:  105863998 NCBI-ProteinID:  XP_012607054 Ensembl:  ENSMICG00000037354 UniProt:  A0A8B7FGH1 LinkDB All DBs Position 2:105062591..105067938 Genome browser AA seq 218 aa AA seqDB search MPMTLGYWELRGLAHAIRLLLEYTDSSYEEKTYTMGDAPDYDRSQWLNEKFKLGLDFPNL PYLIDGAIKITQSNAILRYIARKHNLCGETEEEKIRVDILENQAMDTRMQMATVCYSPDF EKLKPEFLEGLPEKMKLYSQFLGTRPWFAGDKITFVDFLAYDVLDMHRIMEPKCLDAFPN LKDFMARFEGLKKISAYLKTGRFLRGPLFGKMAKWGNK NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgccaatgacgctgggttactgggaactccgcgggctggctcacgccatccgcctgctc ctggaatacacagactcgagctatgaggaaaagacatacacgatgggggacgctcctgac tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg ccctacttaatcgatggggccatcaagatcacccagagcaacgccatcctgcgctacatt gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg gagaaccaggctatggatacccgcatgcagatggccacggtctgctacagccctgacttt gagaaactgaagcccgagttcttagagggcctccctgaaaagatgaagctgtactcacag ttcctggggacacggccctggtttgcaggggacaagatcacctttgtggatttcctcgct tatgatgtccttgatatgcaccgtattatggagcccaagtgcctggacgcgttccccaac ctgaaggacttcatggcccgttttgagggcctgaagaagatctctgcctacttgaagact ggccgcttcctccgaggccctctgtttggaaagatggccaagtggggcaacaaatag

DBGET integrated database retrieval system