Microcebus murinus (gray mouse lemur): 105869952 Help Entry 105869952         CDS       T07238                                  Symbol IL13 Name (RefSeq) interleukin-13   KO K05435   interleukin 13 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04060   Cytokine-cytokine receptor interaction mmur04630   JAK-STAT signaling pathway mmur04657   IL-17 signaling pathway mmur04658   Th1 and Th2 cell differentiation mmur04664   Fc epsilon RI signaling pathway mmur05200   Pathways in cancer mmur05310   Asthma mmur05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105869952 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105869952 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     105869952 (IL13)    04657 IL-17 signaling pathway     105869952 (IL13)    04664 Fc epsilon RI signaling pathway     105869952 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105869952 (IL13)   09163 Immune disease    05310 Asthma     105869952 (IL13)    05321 Inflammatory bowel disease     105869952 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmur04052]     105869952 (IL13) Cytokines and neuropeptides [BR:mmur04052]  Cytokines   Interleukins    105869952 (IL13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL13 ARM_ECM29 Motif Other DBs NCBI-GeneID:  105869952 NCBI-ProteinID:  XP_012617581 Ensembl:  ENSMICG00000030495 LinkDB All DBs Position 19:26451113..26457061 Genome browser AA seq 130 aa AA seqDB search MAPWLTMVIALTCLGGLASPGPVPPSTNLRELIEELVNITQNQKTPLCNGSMVWSLNLTT GVYCEALESLANVSGCSALQKTQRMLRGLCTHKPSARQVPASNTRDTKIEVAQFIKDLLR HLRKLFRKSN NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atggcgccgtggttgaccatggtcatcgctctcacctgcctcggcggcctcgcctcccca ggccctgtgcctccctccacgaacctcagggagctcatcgaggagctagtcaacatcacc cagaaccagaagacgccgctgtgcaacggcagcatggtgtggagcctcaacctgacgacg ggcgtgtactgcgaggccctggagtccctggcgaacgtgtcgggctgcagtgccctccag aagacccagcggatgctgaggggactctgcacgcacaagccctcggccaggcaggtcccc gcctccaacacccgagacaccaagatcgaagtggcccagttcatcaaggacctgctcaga catttaaggaaactctttcgaaagtccaactga

DBGET integrated database retrieval system