KEGG   Microcebus murinus (gray mouse lemur): 105880116
Entry
105880116         CDS       T07238                                 
Symbol
MRAP
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mmur  Microcebus murinus (gray mouse lemur)
Pathway
mmur04927  Cortisol synthesis and secretion
mmur04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmur00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    105880116 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105880116 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ EVC2_like
Other DBs
NCBI-GeneID: 105880116
NCBI-ProteinID: XP_012636370
UniProt: A0A8B7HGT8
LinkDB
Position
31:33256662..33292266
AA seq 167 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSVVIAFWVSLAAFVVLLFLILLYM
SWSGSPQMRNSTQHHHTCPWSHRLNLPLCIQRHLQRHRPPQGTLQAPPSSVEDPGSRAGP
DQWPQQDSPSASLPQARSWPLMGGPKASADVKDKPREPAPVTKPVNC
NT seq 504 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctccgccccgtactacagctatgaatactacctggactac
ctggacctcattcctgtggacgagaagaagctgaaagcccacaaacattccgttgtcatt
gccttctgggtgagcctggctgccttcgtggtgctcctcttcctcatcttgctctacatg
tcctggtcaggctccccacagatgaggaacagcacccagcaccaccacacctgcccctgg
agtcaccgcctcaacctgcccctctgcatccagcggcacctgcaacgccacaggcccccc
caggggaccttacaggctccaccaagctcggtggaggacccagggagcagagctggccct
gaccagtggccgcagcaggacagcccctcagcctcgctcccccaagccaggagctggccc
ttgatggggggccccaaggcatcagctgacgtcaaggacaagcccagggagcctgccccg
gtgacaaaacctgtcaattgctga

DBGET integrated database retrieval system