Myotis myotis (greater mouse-eared bat): 118671844 Help Entry 118671844         CDS       T07220                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04060   Cytokine-cytokine receptor interaction mmyo04061   Viral protein interaction with cytokine and cytokine receptor mmyo04062   Chemokine signaling pathway mmyo04620   Toll-like receptor signaling pathway mmyo04621   NOD-like receptor signaling pathway mmyo04623   Cytosolic DNA-sensing pathway mmyo04668   TNF signaling pathway mmyo05020   Prion disease mmyo05142   Chagas disease mmyo05163   Human cytomegalovirus infection mmyo05164   Influenza A mmyo05168   Herpes simplex virus 1 infection mmyo05323   Rheumatoid arthritis mmyo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     118671844 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118671844 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     118671844 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118671844 (CCL5)    04621 NOD-like receptor signaling pathway     118671844 (CCL5)    04623 Cytosolic DNA-sensing pathway     118671844 (CCL5)    04062 Chemokine signaling pathway     118671844 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     118671844 (CCL5)    05168 Herpes simplex virus 1 infection     118671844 (CCL5)    05163 Human cytomegalovirus infection     118671844 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     118671844 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     118671844 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     118671844 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118671844 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmyo04052]     118671844 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:mmyo00536]     118671844 (CCL5) Cytokines and neuropeptides [BR:mmyo04052]  Cytokines   Chemokines    118671844 (CCL5) Glycosaminoglycan binding proteins [BR:mmyo00536]  Heparan sulfate / Heparin   Chemokines    118671844 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Hydrolase_4 MF_alpha_N Motif Other DBs NCBI-GeneID:  118671844 NCBI-ProteinID:  XP_036196644 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVSAAAFAVLLAAAAFCAPASASPYASDTTPCCFAYISRPLPRAHLQEYFYTSSKCSMP AVVLITRKNRQVCANPEKRWVREIINALEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagctgccttcgctgtcctcctcgccgcagccgccttctgtgctcct gcatcggcctccccatatgcctcggacaccacaccctgctgctttgcctacatctcccgc ccactgccccgtgcccacctccaggagtatttctacaccagcagcaagtgctccatgcca gcagtcgtcttaatcacccgaaagaaccgtcaggtgtgtgccaatccagagaagagatgg gtgcgggagattatcaacgctttggagatgagctag

DBGET integrated database retrieval system