KEGG   Miniopterus natalensis (Natal long-fingered bat): 107523767
Entry
107523767         CDS       T05883                                 
Symbol
CUL1
Name
(RefSeq) cullin-1 isoform X1
  KO
K03347  cullin 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
mna04310  Wnt signaling pathway
mna04340  Hedgehog signaling pathway
mna04350  TGF-beta signaling pathway
mna04710  Circadian rhythm
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107523767 (CUL1)
   04120 Ubiquitin mediated proteolysis
    107523767 (CUL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107523767 (CUL1)
   04340 Hedgehog signaling pathway
    107523767 (CUL1)
   04350 TGF-beta signaling pathway
    107523767 (CUL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107523767 (CUL1)
   04114 Oocyte meiosis
    107523767 (CUL1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    107523767 (CUL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107523767 (CUL1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107523767 (CUL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107523767 (CUL1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     107523767 (CUL1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 107523767
NCBI-ProteinID: XP_016050941
LinkDB
Position
Unknown
AA seq 790 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDFPETNELS
PDSHRPVDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLS
KGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYAVQQLTDSTQIKMDILAQVLQILLKS
KLLVLEDEGANVDEVELRPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEED
RKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVD
GEKDTYSYLA
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgtcatcgaacaggagtcagaatccccatggactgaagcagattggccttgaccagatc
tgggacgacctccgagccgggatccagcaggtgtacaccagacagagcatggcaaagtcc
agatacatggagctctacactcacgtttataactactgcacgagtgttcaccagtcaaac
caagcgcgaggggctggcgtccccccttctaaatcgaaaaaggggcagacgcctggggga
gcgcagtttgtcggcttggaattatacaaacgacttaaagaatttttgaagaattacttg
acaaatcttcttaaggatggagaggacttgatggatgagagtgtgctgaagttctacact
cagcagtgggaagattaccggttctccagcaaagttctcaatggaatttgtgcctacctc
aatagacattgggttcgccgtgagtgtgacgaaggacggaaaggaatatatgaaatctac
tctctggcgttggtgacttggagagattgtctgttcaggcccttgaacaaacaggtaacc
aatgctgttttaaaactgattgaaaaggaaagaaacggtgaaaccatcaatacgagactg
attagtggagttgtccagtcttacgtggagttggggctgaatgaagatgatgcatttgcg
aaaggccctacgttaactgtgtataaagaatcctttgaatctcagtttttggctgacaca
gagagattttataccagagagagtactgaattcttgcagcagaacccagttactgaatac
atgaaaaaggcagaggcccggctgctggaggagcagcggcgcgtgcaggtctaccttcac
gagagcacgcaggacgagctggcgaggaagtgcgagcaggtgctcatcgagaagcacctg
gagattttccacacggagtttcagaacctgctggatgctgacaaaaacgaagatctgggt
cgcatgtataatcttgtatctcgaatccaggatggcctgggagaactgaaaaaacttctg
gagacacacattcataatcagggtcttgcagcaattgaaaagtgtggagaagctgcttta
aatgaccccaaaatgtacgtgcagacagtgctggatgttcataagaagtacaacgccctg
gtcatgtcagcattcaacaacgacgcgggcttcgtggccgccctggacaaggcttgtggg
cgcttcataaacaacaacgccgtcaccaagatggcccagtcgtccagtaagtcccccgag
ctgctggctcgatactgcgactccttgttgaagaagagttccaagaacccagaagaagca
gaactggaagatacactcaatcaggtgatggtcgtcttcaagtacatagaagacaaggac
gttttccagaagttctatgcaaagatgctggccaagagactcgtgcaccagaacagcgcg
agcgacgacgccgaggcgagcatgatctccaagctgaagcaagcatgtgggtttgagtat
acctccaaactgcagcggatgttccaggacatcggcgtgagcaaagatttgaacgagcag
ttcaaaaagcacctgacgaactcggagcccctggattttcctgagactaacgagttgtct
cccgattcccaccgcccagtggacttcagcatccaggtgctgagctctggctcgtggccc
ttccagcagtcctgcaccttcgccttgccgtcggagctggagcgcagctaccagcggttc
accgccttctacgccagccgccacagcggccggaagctgacgtggctgtaccagctgtcc
aagggcgagctggtcacaaactgcttcaagaacaggtacactttgcaggcgtcgacattc
cagatggcgatcctgcttcagtataacacggaggacgcgtacgcggtgcagcagctgacg
gacagcactcagatcaaaatggacattctggcccaggtcctgcagattctgttgaagtcg
aagttgctggtcttggaggacgaaggtgccaacgtggacgaggtggagctgcggcccgac
accctcataaagctctaccttggttacaaaaataaaaaattaagggttaacatcaatgtg
ccaatgaaaaccgaacagaagcaggaacaggaaaccacacacaaaaacattgaggaggac
cgcaaactgctgatccaggcggcgatcgtgaggatcatgaagatgcggaaggtcctgaag
caccagcagctgctcggggaggtgctcacgcagctgtcctcccggttcaagccccgggtc
ccagttatcaagaaatgcattgacattctgatcgagaaagagtatttggagcgagttgat
ggggaaaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system