KEGG   Miniopterus natalensis (Natal long-fingered bat): 107523800
Entry
107523800         CDS       T05883                                 
Symbol
PDIA4
Name
(RefSeq) protein disulfide-isomerase A4
  KO
K09582  protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107523800 (PDIA4)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107523800 (PDIA4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107523800 (PDIA4)
   04131 Membrane trafficking [BR:mna04131]
    107523800 (PDIA4)
Enzymes [BR:mna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     107523800 (PDIA4)
Chaperones and folding catalysts [BR:mna03110]
 Protein folding catalysts
  Protein disulfide isomerase
   107523800 (PDIA4)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107523800 (PDIA4)
SSDB
Motif
Pfam: Thioredoxin OST3_OST6 Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Calsequestrin Thioredoxin_7 AhpC-TSA TraF HyaE
Other DBs
NCBI-GeneID: 107523800
NCBI-ProteinID: XP_016050977
LinkDB
Position
Unknown
AA seq 545 aa
MQNTGSAGEPRYRDSSKEEAVEEEDEEEEEEEDLEVKEENGVLVLSDANFDDFVADKDTV
LLEFYAPWCGHCKQFAPEYEKIASTLKENDPPIPVAKIDATSETALASRFDVSGYPTIKI
LKKGQAVDYEGSRTQDEIIAKVKEISQPNWTPPPEVTLVLTKDNFDEVVDGADIILVEFY
APWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDAIAETDLAQRFGVSSYPTLKIFRKGK
PFEYNGPREKYGIVDYMIEQSGPPSKEILALKQVQEFLKDGDDVIIIGVFQAESDPAYQL
YQEAANNLREDYKFHHTFSTEIAKFLKVSPGKLVMMQPEKFQSKYEPRSNVMDIQGSTEG
SAIKDFVLKHTLPLVGHRKPANDAKRYARRPLVVVYYSVDFSFDYRAGKLKPVIKSQPVP
KNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYASLGKKYKSHKNLVI
AKMDATANDITSDRYKVEGFPTIYFAPSGDKKNPIKFEDGNRDLEHLSKFIEEHATKPSR
TREDL
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgcaaaacacaggcagtgcaggggagcctcgctacagggattccagtaaagaagaggcc
gtggaggaggaagacgaggaggaggaggaagaggaggacctggaagtcaaggaggaaaac
ggcgtgctcgtcctcagtgacgccaacttcgacgacttcgtggccgacaaggacaccgtg
ctgctggagttctacgctccgtggtgcggacattgcaagcagtttgctccagagtatgaa
aaaatcgccagtaccttgaaagagaacgaccctcccattcctgtcgctaagatagacgcg
acctcagagacagcgctggccagcaggttcgatgtgagcggctaccccaccatcaagatc
ctcaagaaggggcaggctgtcgactacgagggctccaggacccaggacgaaattatcgcc
aaggtcaaggagatctcccagcccaactggacgcctccaccggaagtcacactcgtgctg
accaaagataacttcgacgaggtggtggatggtgcagacatcatcctggtggagttttac
gctccctggtgtggacactgcaagaagctggcccccgagtatgagaaggctgccaaggag
ctgagcaagcgctctcccccaatccccctggccaaggtggacgccatcgcggagacagac
ctggcgcagaggttcggtgtctccagctatcccaccctgaagatcttccgcaagggaaag
cctttcgaatacaatggcccgcgagagaaatacgggattgttgactacatgatcgagcag
tccgggccaccctccaaggagatcttggccctgaagcaggtccaggagttcctgaaggat
ggagacgatgtcatcatcattggggtcttccaggcggagagtgacccggcctaccagctg
taccaggaagctgctaacaacctgagggaagattacaaattccaccacaccttcagcact
gaaatagcaaagttcttgaaagtctcccctgggaagctggtcatgatgcagcctgagaaa
ttccagtccaaatacgagcccaggagcaacgtgatggacatccagggctccacggagggc
tcggccatcaaggacttcgtgctgaagcacacgctgcccctcgtgggtcaccgcaagccc
gccaacgacgccaagcggtacgcgcggcgccccctggtggtcgtgtactacagcgtggac
ttcagcttcgactaccgagcgggaaaactgaagccggtcatcaaatcccagccggtgccc
aagaacaacaagggacctgtcaaggtcgtggtggggaagaccttcgactccatcgtgatg
gaccccaagaaggacgtgctcatcgagttctacgcgccctggtgcgggcactgcaagcag
ctggagcccgtgtacgcctccctgggcaagaagtacaagagccataagaacctggtcatc
gccaagatggatgccactgccaacgacatcaccagcgaccgctacaaagtcgagggcttc
cccaccatctacttcgcgcccagtggggacaaaaagaacccgattaagtttgaggacgga
aacagagacctggaacatttgagcaagtttatagaggaacatgccacaaaacccagcagg
accagggaagacctttaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107529127
Entry
107529127         CDS       T05883                                 
Symbol
TXNDC5
Name
(RefSeq) thioredoxin domain-containing protein 5
  KO
K13984  thioredoxin domain-containing protein 5
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107529127 (TXNDC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107529127 (TXNDC5)
   04131 Membrane trafficking [BR:mna04131]
    107529127 (TXNDC5)
Chaperones and folding catalysts [BR:mna03110]
 Protein folding catalysts
  Protein disulfide isomerase
   107529127 (TXNDC5)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107529127 (TXNDC5)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_6 HyaE OST3_OST6
Other DBs
NCBI-GeneID: 107529127
NCBI-ProteinID: XP_016057916
LinkDB
Position
Unknown
AA seq 323 aa
MEDAKVYVAKVDCTANSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFQALENWMLQTL
NEEPATPEPVVEPPRAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWE
QLALGLEHSETVKIGKVDCTQHHELCSGNQVRGYPTLLWFRDGKKIDQYKGKRDLDSLRE
YVESQFQNADRGAPETPPSEAPVLPVEPKADKGAVLALTENNFDDTIAEGLTFVKFYAPW
CGHCKNLAPTWEELSKKEFPGLAEVKVAEVDCTAERNICNKYSVRGYPTLLLFRGGKKVS
EHSGGRDLESLHHFVLSQAKDEL
NT seq 972 nt   +upstreamnt  +downstreamnt
atggaagatgccaaagtctacgtggctaaagtggactgcacggccaactcagacgtgtgc
tccgcccagggggtccgaggataccccaccttgaagtttttcaagcctggccaagaagct
gtgaaataccaaggtccccgggacttccaggcactggaaaactggatgctgcagacgctg
aacgaggagcccgctacaccagagccagtagtagaaccacccagagcccctgagcttaag
caggggctgtatgaactttcagcgagcaacttcgagctgcacgtcgcacaaggcgaccac
tttatcaagttctttgctccatggtgtggtcactgcaaagctctggctccgacctgggag
cagctggccctgggcctcgaacattccgaaactgtcaagattggcaaggtggactgcaca
cagcaccatgagctctgctcgggaaaccaggtccgcggctaccccacgctcctctggttc
cgggacggtaagaagattgaccagtacaagggaaagcgggatctggactcgctgagagaa
tacgtggaatcacagttccagaacgcggacaggggtgccccagagaccccgccctcggag
gccccagtgctgcctgtagagcccaaggctgacaagggcgctgtgttggcactcacggaa
aataactttgatgacactattgcagaaggattgaccttcgtcaagttttatgctccatgg
tgtggccactgtaagaatctggctcctacctgggaagaactctctaaaaaggaattccct
ggcttggcagaggtcaaggtcgctgaagtggactgtactgctgaacgcaatatttgcaac
aagtactcggtacgaggctatcccacattgttgcttttccgcggaggaaaaaaagtcagt
gagcacagtgggggcagagaccttgaatcgttgcaccactttgttctgagccaggcgaaa
gatgaactataa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107529612
Entry
107529612         CDS       T05883                                 
Symbol
ERP29
Name
(RefSeq) endoplasmic reticulum resident protein 29
  KO
K09586  endoplasmic reticulum protein 29
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107529612 (ERP29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107529612 (ERP29)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107529612 (ERP29)
SSDB
Motif
Pfam: ERp29_N ERp29
Other DBs
NCBI-GeneID: 107529612
NCBI-ProteinID: XP_016058570
LinkDB
Position
Unknown
AA seq 260 aa
MAAAVLRAASLSPVFPFFLFLLLLSAPPGSSGLHTKGALPLDTVTFYKVIPKSKFVLVKF
DTQYPYGEKQDEFKRLAENSASSDDLLVAEVGVSDYGDKLNMELSEKYKLDKENYPVYYL
FRDGDVENPVLYSGAVKVGAIQRWLKGQGVYLGMPGCLPAYDALAGEFVRASGVEARRAL
LKRGQDNLASVKETEKKWAEQYLKIMGKVLDQGEDFPASEMTRITKLIENKMSDGKKAEL
QKSLNILTAFQKKGAEKEEL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggctgccgccgtcctccgcgccgcttctctctccccagtgtttccctttttcttgttc
ctcctgcttctctccgctccgccgggcagcagcggcctgcacaccaagggtgcccttccc
ctggatacagtcactttctacaaggtcattcccaaaagcaagttcgtcctggtgaagttc
gacacccagtatccctacggtgagaagcaggatgagttcaagcgtctggctgagaactcg
gcctccagcgatgacctcttggtggcagaggtgggagtctcagattatggggacaagctg
aatatggagctaagtgagaaatacaagctggacaaagagaactacccagtctactacctc
ttccgggatggggacgttgagaacccagtcctgtatagtggggcagttaaggttggagcc
atccagcgctggctgaaggggcaaggggtctacctaggcatgcctggctgcctgcctgcc
tacgacgcccttgctggagagttcgtcagggcctctggcgtggaggcccgccgggccctt
ttgaagcgggggcaggacaacctcgcaagtgtgaaggagactgagaagaagtgggccgag
cagtacctgaagatcatggggaaggtcttagaccaaggtgaggacttcccggcgtcagag
atgacccggatcaccaagctgattgagaacaagatgagcgatgggaagaaggcagagctc
cagaagagcttaaacatcttgactgccttccagaagaagggagccgaaaaggaggagctt
taa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107539045
Entry
107539045         CDS       T05883                                 
Symbol
P4HB
Name
(RefSeq) protein disulfide-isomerase
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107539045 (P4HB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107539045 (P4HB)
   04131 Membrane trafficking [BR:mna04131]
    107539045 (P4HB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539045 (P4HB)
Enzymes [BR:mna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     107539045 (P4HB)
Chaperones and folding catalysts [BR:mna03110]
 Protein folding catalysts
  Protein disulfide isomerase
   107539045 (P4HB)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107539045 (P4HB)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   107539045 (P4HB)
  Exosomal proteins of colorectal cancer cells
   107539045 (P4HB)
  Exosomal proteins of bladder cancer cells
   107539045 (P4HB)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 ERp29_N Thioredoxin_7 Calsequestrin Thioredoxin_8 HyaE Redoxin
Other DBs
NCBI-GeneID: 107539045
NCBI-ProteinID: XP_016070905
LinkDB
Position
Unknown
AA seq 486 aa
MTWLWPPGLQNSLPVVTCIKHLAFLPDAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKV
DATEESDLAQQYGVRGYPTIKFFKNGDTASPREYTAGREADDIVNWLKKRTGPAATMLPD
GAAAETLVESSEVTVIGFFKDVESDFAKQFLLAAEAIDDIPFGITSNSDVFSKYQLGKDG
VVLFKKFDEGRNDFEGEITKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLP
KSVSDYEGKLSNFKKAAQSFKGKILFIFIDSDHADNQRILEFFGLKKEECPAVRLITLEE
EMTKYKPESDELTAEKITDFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAF
DEKRNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIIIAKMDATANEVEAVKVHSFPT
LKFFPAGPDKTVIDYNGERTLDAFKKFLESGGQDGAGDGDDLEDLEEAEEPDLEEEDTQK
AVKDEL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgacttggctatggccacctgggctgcagaacagcctccctgtggtcacctgcatcaag
catcttgctttccttccagatgccccctggtgtggccactgcaaagccctggcccctgag
tatgccaaagcagctgggaagctgaaggccgaaggctccgagatcaggctggcaaaggtc
gatgccacggaggagtctgatctggcccagcagtatggtgtccgcggctaccccaccatc
aagttcttcaagaacggagacacggcttcccccagagagtacacagctggcagagaggct
gatgacattgtgaactggctgaagaagcgcaccggccccgcagccaccatgttgccagac
ggggctgctgcagaaaccttggtggagtccagtgaggtgacagtcatcggattcttcaag
gacgtggagtcggactttgccaagcagttcctgctggcagcagaggccattgatgacata
ccctttgggatcacatccaacagtgatgttttctccaaataccagctgggcaaggatggg
gtcgtcctctttaagaagtttgatgaaggccggaacgactttgagggggagatcaccaag
gagaagctgctggacttcatcaagcacaaccagctaccgctggtcatcgagttcaccgag
cagacggccccgaagatctttgggggtgaaatcaagactcacatcctgctgttcctgcca
aagagcgtgtctgactatgaggggaaactgagcaacttcaagaaagccgcccagagcttc
aagggcaagatcctgtttatattcatcgacagtgaccatgccgacaaccagcgcatcctc
gagttcttcggcctcaagaaggaggagtgtcccgccgtgcggctcatcaccctggaggag
gagatgaccaagtacaagcctgagtctgacgagctgacggctgagaaaatcacggacttc
tgccaccgcttcctggagggcaagatcaagcctcacctgatgagccaggagctgcctgag
gactgggacaagcagcctgtgaaagtgctcgtcgggaagaactttgaagaggttgccttt
gatgagaaaaggaacgtgtttgtggaattctatgccccgtggtgtggtcactgcaagcag
ttggctcccatttgggataagctgggagagacgtacaaggaccatgaaaatattatcatc
gccaagatggacgcaacagctaacgaggtggaggccgtcaaagtgcacagcttccccaca
ctcaagttcttccctgccggcccggacaaaacggtcattgattacaacggagagcggacc
ctagatgcttttaagaagttcttggagagcggtggccaggacggggcaggggatggcgat
gatctggaagatctagaggaagcagaggagcccgacttggaagaagaggacacccagaag
gctgtgaaagacgagctgtga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107543536
Entry
107543536         CDS       T05883                                 
Symbol
PDIA6
Name
(RefSeq) protein disulfide-isomerase A6
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107543536 (PDIA6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107543536 (PDIA6)
   04131 Membrane trafficking [BR:mna04131]
    107543536 (PDIA6)
Enzymes [BR:mna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     107543536 (PDIA6)
Chaperones and folding catalysts [BR:mna03110]
 Protein folding catalysts
  Protein disulfide isomerase
   107543536 (PDIA6)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107543536 (PDIA6)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 OST3_OST6 Thioredoxin_6 Thioredoxin_7 Thioredoxin_8 Thioredoxin_3 Calsequestrin Thioredoxin_9
Other DBs
NCBI-GeneID: 107543536
NCBI-ProteinID: XP_016076584
LinkDB
Position
Unknown
AA seq 464 aa
MEGLRQLKKTLVTWVSFQHKPAVNGLLLVVPPGLVSCTFFLTVNGLYSSSDDVIELTPSN
FNQEVIQSNSLWLVEFFAPWCGHCQRLTPEWKKVATALKDVVKVGAVDADKHQSLGGQYG
VQGFPTIKIFGSNKNRPEDYQGGRTADAIVDSALSALRQLVKDRLGGRGYSSGKQGRSES
TSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK
LAAVDATVNQMLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSEIVSRALDLFSDNAPPP
ELLEIISEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLW
TEAGAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTA
PVGGGVFPSISTREPWDGQDGELPVEDDIDLSDVELDDLERDEL
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggagggccttcgtcagctgaagaagactctggtcacctgggtttcctttcagcacaaa
cctgctgttaatggtctgcttttggttgttcctccaggtttggtgagctgtaccttcttt
ctaacagtgaatgggttgtattcctctagtgatgatgtcatcgagttaactccatcaaat
ttcaaccaagaagttattcagagtaatagcttgtggcttgtagaattctttgctccatgg
tgtggccactgccaaaggttaacaccagaatggaagaaagtagcaactgcattaaaagat
gttgtaaaagtgggtgcagttgacgcagataaacatcagtcccttggaggacagtatggg
gtgcagggattccctaccatcaagatttttggatctaacaaaaacaggccagaagattat
cagggtggcaggactgctgatgccatcgtggattccgccctcagtgccctgcgccagctc
gtcaaggatcgccttgggggcaggggatatagttctggaaaacaaggtagaagcgaaagt
acaagtaagaaagacgtgattgagctgacagacgacagctttgataagaatgttcttgac
agtgaagacgtttggatggttgagttttatgctccttggtgtggacactgcaaaaaccta
gagccagaatgggccgctgcagctaccgaggtaaaagagcagacgaaaggaaaggtgaaa
ctagcggctgtggacgccacggtcaatcagatgctagccagccgatacgggattcgggga
tttcctacaatcaagatctttcagaaaggcgagtctcctgtggattatgacgggggccgg
acaagatctgaaattgtctcccgggccctcgatttgttttctgataacgctccacctcct
gagctacttgagatcattagtgaggacatcgccaagaagacgtgcgaggaacatcagctc
tgtgtcgtggccgtcctgccccacattcttgacactggagctgcaggcagaaattcttat
ttggaagttcttctgaagttggcagacaaatacaaaaagaaaatgtgggggtggctgtgg
acagaagctggagcacagtccgaactcgagaatgctttggggattggaggatttgggtac
cccgccatggcagccattaacgcacgcaagatgaagtttgctcttctaaaaggatctttc
agtgagcaaggcattaacgagtttctcagggagctatcttttgggcgaggatctacagca
cctgtcggaggtggagttttcccctccatcagcaccagagagccttgggacggccaggat
ggtgagcttcctgtggaagatgacattgacctcagcgacgtggagctggatgacttggag
agagatgagctgtga

DBGET integrated database retrieval system