KEGG   Miniopterus natalensis: 107523964
Entry
107523964         CDS       T05883                                 

Gene name
CBLB
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-B
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis
Pathway
mna04012  ErbB signaling pathway
mna04120  Ubiquitin mediated proteolysis
mna04144  Endocytosis
mna04625  C-type lectin receptor signaling pathway
mna04660  T cell receptor signaling pathway
mna04910  Insulin signaling pathway
mna05162  Measles
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107523964 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107523964 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107523964 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107523964 (CBLB)
   04660 T cell receptor signaling pathway
    107523964 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107523964 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    107523964 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107523964 (CBLB)
   04121 Ubiquitin system [BR:mna04121]
    107523964 (CBLB)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107523964 (CBLB)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    107523964 (CBLB)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    107523964 (CBLB)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_2 zf-RING_5 zf-C3HC4_4 zf-rbx1 zf-RING_4 UBA
Other DBs
NCBI-GeneID: 107523964
NCBI-ProteinID: XP_016051169
LinkDB
Position
Unknown
AA seq 924 aa
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMTRLANVRKCTERQNSPVTS
PGSSPIAQRRKPQQDPLQIPHLSLPPVPPRLDLIHKGMVRSPCGSPTGSPKASPCLARKT
EHLCNQVVAAKIIFSLMKWVQWEHGIQNEMMLNVFIPPSPGPPEVKFCTNRSLSFQVFSN
GHLGSEEYDVPPRLSPPPPAAALLPSIKCTGPLANSLSEKTREPAEEDDDEYKIPSSHPV
SPSSQPSPCHNVKPLRSYDNGHCILNGTHGTTSEMKKLHIPELGLYVKGDVFDSASDPVP
LPPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEGAFDALPPSLPPPPPPARHSLIEHSK
PPGSGSRPSSGQDLFLLPSDPFFDPASGQVPLPPARRLPGETVKANRTSQDYDQLPPSSD
GSQAPARPPKPRPRRTAPEIHHRKPHGPEAAENVDGKIAKLMGEGYAFEEVKRALEIAQN
NVEVARSILREFAFPPPVSPRLNL
NT seq 2775 nt   +upstreamnt  +downstreamnt
atggcaaattctatgaatggcagaaaccctggtggtcgaggaggaaacccccgaaaagga
agaattttaggcattattgatgctattcaagatgcagtgggaccccctaagcaagcagca
gcggatcgcagaactgtggagaaaacttggaaactcatggacaaagtggtcagactgtgc
caaaatcccaagcttcagttgaaaaacagcccaccatatatacttgacattttacctgat
acctatcagcatttgcgacttatattgagtaaatatgatgacaaccagaaacttgcccag
ctcagtgagaatgagtattttaaaatctacattgatagtctaatgaaaaagtcaaagcgg
gccatacgactcttcaaagagggcaaggagaggatgtatgaggagcagtcgcaggacagg
cgaaatctgacaaaactgtcccttatcttcagtcacatgctggcagaaattaaagcaatc
tttcccaatgggcaattccagggagataattttcgtatcacgaaagcggatgctgctgaa
ttctggagaaagttttttggagacaaaactattgtgccatggaaagtattcagacagtgc
cttcatgaggtccatcaaattagctctggcctggaagcaatggctctaaaatcaacaatt
gatttaacatgtaatgattatatttcggtttttgaatttgatatttttaccaggctattt
cagccttggggctctattctgcggaattggaatttcttggctgtaacacatcctggttac
atggcgtttctcacctatgatgaagtgaaggcacgcctgcagaagtacagcaccaaacct
ggaagctacattttccggttaagctgcactagattgggacagtgggccatcggctatgtg
acaggggatggcaatatcttacagaccatacctcataacaagcccttatttcaagccctg
attgatggcagcagggaaggattctacctttatcccgatggaaggagttataatcctgat
ttaactggattatgtgaacctacaccccatgatcatataaaagttacacaggaacaatat
gaattatattgtgaaatgggctccactttccagctctgtaaaatctgtgctgagaatgat
aaagatgtcaagattgagccttgtgggcatttgatgtgcacctcttgccttacagcgtgg
caggagtcagatggccagggctgccccttctgtcgctgtgaaataaaaggaacagagccc
ataattgtggacccctttgatccaagagatgaaggctccaggtgctgcagcatcatcgac
cccttcggaatgccgatgctggacttggacgacgacgacgaccgagaggagtccctgatg
atgactcggctggccaatgttcggaagtgcactgagagacagaattcaccagtcacctcc
ccagggtcgtcgcccattgcacagcgaagaaagccacagcaggaccctctgcagatccca
cacctcagcctgccgccggtgcctccccgcctggacctgattcacaaaggcatggttcgg
tctccgtgcggcagcccaaccggttcaccaaaggcctccccctgcctggcgaggaagaca
gaacacctatgcaaccaggtagtggcagctaaaataattttcagtttaatgaaatgggta
cagtgggaacatggaattcagaatgaaatgatgttaaatgttttcattccaccatcacca
ggccctccagaagttaagttctgcactaaccgttcgctttcctttcaggtcttttccaac
ggccacctgggaagtgaagagtatgatgtcccccctcggctctccccccctccgccagct
gccgccctcctccctagcatcaagtgtactggtccattagcaaattctctttcagagaaa
acaagagagccggcagaggaagatgacgatgaatataagattccttcatcccatcctgtt
tccccgagttcacaaccatctccttgtcataatgtaaaacctcttaggtcttatgataac
ggtcattgtatattgaatggaacacatggtacaacttcagagatgaagaaattacacatc
cctgagttaggcttatatgtaaagggagatgtttttgattcagcctctgatccagtgcca
ttgccacctgccaggcctccaacccgggacaatccaaagcatggctcttcactcaacagg
acgccctctgattatgatcttctcatccctccattaggtgaaggtgcttttgatgccctc
cccccatccctcccacctcccccacctcctgcaagacatagtctcatcgaacattcaaaa
cctcctggctccggtagccggccatcctcaggacaagaccttttccttcttccttcagat
cccttttttgaccctgcaagcggccaagttcctctgcctcctgcaaggaggttgccaggt
gagaccgtcaaagccaacagaacctcacaggattacgatcagcttcctccgtcttcagat
ggttcacaagcaccagccagacctcctaaaccgcggccccgcaggactgccccagaaatt
caccacagaaagccccacgggcccgaggcagcggaaaacgtcgatgggaaaatcgcgaaa
ctcatgggagagggttatgcgtttgaagaggtgaagagagccttagagatcgcccagaat
aacgtcgaagtggcccggagcatcctccgagaatttgccttcccccctccagtgtccccg
cgtctaaatctatag

DBGET integrated database retrieval system