KEGG   Miniopterus natalensis: 107524437
Entry
107524437         CDS       T05883                                 

Definition
(RefSeq) histone H3.3C-like
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107524437
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107524437
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107524437
  09165 Substance dependence
   05034 Alcoholism
    107524437
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107524437
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107524437
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107524437
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107524437
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 107524437
NCBI-ProteinID: XP_016051836
LinkDB
Position
Unknown
AA seq 147 aa
MACTKQTAPKLTSGKEPRKLLATKATHKSSPFTGGVKKPHRYRPGTVALHEIRRYQKSTE
LLILKLPFQCPLQEISQDFKTDQRFQSAAIGALQEASEAYVVGLFEDTNLCVTHAKRLTI
MLKDIQLGHCMRRTCLRVHYDGKHFIL
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcttgtacaaagcagactgcccccaaattgaccagtggtaaagaaccgaggaagcta
ctggctaccaaagccactcacaagagttcaccctttactggaggggtgaagaaacctcac
cgttacaggcctggtaccgtggcactccatgaaattagacgttatcagaagtccactgaa
cttctgattctcaaacttcccttccagtgtccgctgcaagaaatttctcaggacttcaaa
acagatcagcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaagcctat
gtggttggcctttttgaagacaccaacctgtgtgttactcatgccaaacggttaacaatt
atgctgaaagacatccagttaggacactgtatgcgtagaacgtgcttaagagtccactat
gatgggaaacatttcattctttaa

KEGG   Miniopterus natalensis: 107535790
Entry
107535790         CDS       T05883                                 

Definition
(RefSeq) histone H3.3-like
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107535790
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107535790
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107535790
  09165 Substance dependence
   05034 Alcoholism
    107535790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107535790
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107535790
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107535790
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107535790
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S TMA7
Other DBs
NCBI-GeneID: 107535790
NCBI-ProteinID: XP_016066852
LinkDB
Position
Unknown
AA seq 136 aa
MAGTKQTACKSTSGEAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALPEIRRYQKSTE
LLIRKLPFRRLVREIAQDFKTDLRFQSATIGALQEASEAYLVGLFEDTNLCAIHAKRVAI
MPKDIQLASCIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctggtacaaagcagactgcctgcaaatccaccagtggtgaagcacctcggaagcaa
ctggctaccaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcac
cgttacaggcctggtactgtggcacttcctgaaattaggcgttatcagaagtccactgaa
cttctgattcgcaaactccccttccggcgtctggtgcgagaaatcgctcaggacttcaaa
acagatctgcgcttccagagtgcaactattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtagcaatt
atgccaaaagacatccagctagcaagctgcatacgtggagaacgtgcttaa

KEGG   Miniopterus natalensis: 107536632
Entry
107536632         CDS       T05883                                 

Gene name
H3F3B
Definition
(RefSeq) histone H3.3
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107536632 (H3F3B)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107536632 (H3F3B)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107536632 (H3F3B)
  09165 Substance dependence
   05034 Alcoholism
    107536632 (H3F3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107536632 (H3F3B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107536632 (H3F3B)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107536632 (H3F3B)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107536632 (H3F3B)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 107536632
NCBI-ProteinID: XP_016067936
LinkDB
Position
Unknown
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgctcgcaaatccacgggtgggaaagcgccccgcaaacag
ctggccactaaagctgccaggaaaagcgctccctctaccggcggggtgaagaaaccccat
cgctacaggcccggaaccgttgcgcttcgagaaatacgtcgttaccagaaatcgaccgag
cttctgatccggaagctgcctttccagaggttggtgagggagatagcccaggatttcaag
accgacctgaggtttcagagtgccgccatcggggcgctgcaggaggccagcgaagcgtac
ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc
atgcccaaagacatccagttggctcgccggatacggggggagagagcttaa

KEGG   Miniopterus natalensis: 107539695
Entry
107539695         CDS       T05883                                 

Definition
(RefSeq) histone H3.1 isoform X1
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539695
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107539695
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539695
  09165 Substance dependence
   05034 Alcoholism
    107539695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539695
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539695
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539695
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539695
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 107539695
NCBI-ProteinID: XP_016071754
LinkDB
Position
Unknown
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcggacgaagcagacggcgcgcaagtccacgggcgggaaggcgccgcgcaagcag
ctggcgaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggcgctgcgcgagatccgccgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctcgcgcgccgcattcgcggggagagggcgtaa

KEGG   Miniopterus natalensis: 107539696
Entry
107539696         CDS       T05883                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539696
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107539696
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539696
  09165 Substance dependence
   05034 Alcoholism
    107539696
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539696
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539696
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539696
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539696
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 107539696
NCBI-ProteinID: XP_016071757
LinkDB
Position
Unknown
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcggacgaagcagacagcgcgcaagtccacgggcgggaaggcgccgcgcaagcag
ctggcgaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggcgctgcgcgagatccgccgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctcgcgcgccgcatccgcggggagagggcctga

KEGG   Miniopterus natalensis: 107539697
Entry
107539697         CDS       T05883                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539697
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107539697
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539697
  09165 Substance dependence
   05034 Alcoholism
    107539697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539697
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539697
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539697
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539697
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 107539697
NCBI-ProteinID: XP_016071758
LinkDB
Position
Unknown
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcggacgaagcagacggcgcgcaagtccacgggcgggaaggcgccgcgcaagcag
ctggcgaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggcgctgcgcgagatccgccgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctcgcgcgccgcatccgcggggagagggcgtaa

KEGG   Miniopterus natalensis: 107539717
Entry
107539717         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC107539717
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539717
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107539717
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539717
  09165 Substance dependence
   05034 Alcoholism
    107539717
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539717
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539717
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539717
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539717
SSDB
Motif
Pfam: Histone CENP-T_C TAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP PAF
Other DBs
NCBI-GeneID: 107539717
NCBI-ProteinID: XP_016071778
LinkDB
Position
Unknown
AA seq 334 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGGXAPAAAHVLGKSSMART
KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIR
KLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAILTMSGRGKGGK
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRD
AVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctggtcgcggcaaaggcgggaagggcctcgggaagggcggcgccaagcgccaccgc
aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcgcctggcgcgg
cgcggcggcgtcaagcgcatctccgggctcatctacgaggagacccgcggggtgctcaag
gtgttcctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaag
acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc
ttcggcggctgagcccccgcggccgcccacgtcctcgggaagagctccatggctcggacg
aagcagacggcgcgcaagtccacgggcgggaaggcgccgcgcaagcagctggcgaccaag
gcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcaccgctaccggccc
ggcacggtggcgctgcgcgagatccgccgctaccagaagtccacggagctgctgatccgc
aagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaagaccgacctgcgc
ttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctacctggtggggctc
ttcgaggacaccaacctgtgcgccatccttaccatgtctggtcgcggcaaaggcgggaag
ggcctcgggaagggcggcgccaagcgccaccgcaaggtgctgcgcgacaacatccagggc
atcaccaagcccgccatccggcgcctggcgcggcgcggcggcgtcaagcgcatctccggg
ctcatctacgaggagacccgcggggtgctcaaggtgttcctggagaacgtgatccgcgac
gccgtcacctacacggagcacgccaagcgcaagacggtcacggccatggacgtggtctac
gcgctcaagcgccagggccgcaccctctacggcttcggcggctga

KEGG   Miniopterus natalensis: 107542812
Entry
107542812         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC107542812
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107542812
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107542812
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107542812
  09165 Substance dependence
   05034 Alcoholism
    107542812
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107542812
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542812
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107542812
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542812
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa TAF PAF Bromo_TP
Other DBs
NCBI-GeneID: 107542812
NCBI-ProteinID: XP_016075749
LinkDB
Position
Unknown
AA seq 400 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERAXTPKGSAKGVYKTLRGLVVFVPTADMSGRGKGGKGLGKGGAKRH
RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKR
KTVTAMDVVYALKRQGRTLYGFGAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA
CEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggctcggacgaagcagacggcgcgcaagtccacgggcgggaaggcgccgcgcaagcag
ctggcgaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggcgctgcgcgagatccgccgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctcgcgcgccgcatccgcggggagagggcgtaaactcccaag
gggtccgcaaaaggcgtatataaaacactgcgagggttggttgtgtttgttccgactgca
gacatgtctggtcgcggcaaaggcgggaagggcctcgggaagggcggcgccaagcgccac
cgcaaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcgcctggcg
cggcgcggcggcgtcaagcgcatctccgggctcatctacgaggagacccgcggggtgctc
aaggtgttcctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgc
aagacggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctac
ggcttcggcgccatggctcggacgaagcagacggcgcgcaagtccacgggcgggaaggcg
ccgcgcaagcagctggcgaccaaggcggcccgcaagagcgcgccggccacgggcggcgtg
aagaagccgcaccgctaccggcccggcacggtggcgctgcgcgagatccgccgctaccag
aagtccacggagctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcg
caggacttcaagaccgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcg
tgcgaggcctacctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaag
cgcgtcaccatcatgcccaaggacatccagctcgcgcgccgcatccgtggggagagggct
taa

KEGG   Miniopterus natalensis: 107542813
Entry
107542813         CDS       T05883                                 

Definition
(RefSeq) histone H3.1-like
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107542813
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107542813
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107542813
  09165 Substance dependence
   05034 Alcoholism
    107542813
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107542813
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542813
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107542813
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542813
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 107542813
NCBI-ProteinID: XP_016075750
LinkDB
Position
Unknown
AA seq 90 aa
VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFE
DTNLCAIHAKRVTIMPKDIQLARRIRGERA
NT seq 273 nt   +upstreamnt  +downstreamnt
gtggcgctgcgcgagatccgccgctaccagaagtccacggagctgctgatccgcaagctg
cccttccagcgcctggtgcgcgagatcgcgcaggacttcaagaccgacctgcgcttccag
agctcggccgtcatggcgctgcaggaggcgtgcgaggcctacctggtggggctcttcgag
gacaccaacctgtgcgccatccacgccaagcgcgtcaccatcatgcccaaggacatccag
ctcgcgcgccgcatccgcggggagagggcgtaa

KEGG   Miniopterus natalensis: 107543630
Entry
107543630         CDS       T05883                                 

Gene name
H3F3A
Definition
(RefSeq) histone H3.3
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107543630 (H3F3A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107543630 (H3F3A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107543630 (H3F3A)
  09165 Substance dependence
   05034 Alcoholism
    107543630 (H3F3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107543630 (H3F3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107543630 (H3F3A)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107543630 (H3F3A)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107543630 (H3F3A)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 107543630
NCBI-ProteinID: XP_016076697
LinkDB
Position
Unknown
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa
ctggctaccaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtaccgtggcacttcgtgaaattaggcgttatcagaagtccactgaa
cttctgattcgcaaactccccttccagcgtctggtgcgagaaattgctcaggacttcaaa
acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

KEGG   Miniopterus natalensis: 107545385
Entry
107545385         CDS       T05883                                 

Definition
(RefSeq) histone H3.1-like
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107545385
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107545385
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107545385
  09165 Substance dependence
   05034 Alcoholism
    107545385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107545385
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545385
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107545385
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107545385
SSDB
Motif
Pfam: Histone CENP-S CBFD_NFYB_HMF CENP-T_C PAF
Other DBs
NCBI-GeneID: 107545385
NCBI-ProteinID: XP_016078960
LinkDB
Position
Unknown
AA seq 131 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRI
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcccgtaccaagcagactgctcgcaagtcgaccggtggcaaggccccgcgcaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac
cgctaccgcccgggcaccgtggcgctgcgcgagatccgccgctaccagaagtccaccgag
ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctcgcgcgccgcatc

KEGG   Miniopterus natalensis: 107545386
Entry
107545386         CDS       T05883                                 

Definition
(RefSeq) histone H3-like
  KO
K11253  histone H3
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05202  Transcriptional misregulation in cancer
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107545386
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107545386
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107545386
  09165 Substance dependence
   05034 Alcoholism
    107545386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107545386
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545386
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107545386
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107545386
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 107545386
NCBI-ProteinID: XP_016078961
LinkDB
Position
Unknown
AA seq 92 aa
GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL
FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
NT seq 279 nt   +upstreamnt  +downstreamnt
ggcaccgtggcgctgcgcgagatccgccgctaccagaagtccaccgagctgctgatccgc
aagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaagaccgacctgcgc
ttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctacctggtggggctg
ttcgaagacaccaacctgtgcgccatccacgccaaacgtgtcaccatcatgcccaaggac
atccagctggctcgccgcattcgcggggagcgggcttaa

DBGET integrated database retrieval system