KEGG   Miniopterus natalensis: 107524793
Entry
107524793         CDS       T05883                                 

Gene name
ICOS
Definition
(RefSeq) inducible T-cell costimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04660  T cell receptor signaling pathway
mna04672  Intestinal immune network for IgA production
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107524793 (ICOS)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107524793 (ICOS)
   04672 Intestinal immune network for IgA production
    107524793 (ICOS)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    107524793 (ICOS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107524793 (ICOS)
CD molecules [BR:mna04090]
 Proteins
  107524793 (ICOS)
SSDB
Motif
Pfam: V-set_2
Other DBs
NCBI-GeneID: 107524793
NCBI-ProteinID: XP_016052344
LinkDB
Position
Unknown
AA seq 203 aa
MDRQCIREFMGIRDGDGEIDDFMKSEMFTFHRGGIQILCRCPERVQEFRMELLKGTQIVC
DLSKRKGSGSAKSLGSPGLCQSSNSSLSYFVNGLDRSHESSYSCKLSIFDPPPFQEILRR
EYLHIYESQLCCQLKFWLPIGCAAFAVVYICGCTFFCWFMNKKHRTSVHDPNSEYMFMAA
VNTAKKPRLSDVAHNLGLSNTQG
NT seq 612 nt   +upstreamnt  +downstreamnt
atggacaggcaatgtatacgagaatttatgggtatcagagatggagatggagaaatcgat
gattttatgaagtctgaaatgttcacatttcacaggggaggcatacaaatcttgtgcagg
tgccccgagcgggtccaggagttcaggatggagctgctgaaagggacgcaaatagtctgt
gacctcagcaagagaaagggcagcgggagtgccaagtccctcgggagcccggggctctgc
cagtcgtccaacagcagcctgtcgtacttcgtgaacggcttggacaggtcccatgagagc
tcctactcctgcaagctgtccatttttgaccctcctcctttccaagagattctgaggaga
gaatatttgcatatttatgaatcacagctttgctgccagctgaagttctggctacccata
ggatgtgcagcttttgctgtagtctacatttgtggatgcacatttttttgctggtttatg
aacaagaagcatcgaaccagcgtgcacgaccctaacagtgaatacatgttcatggctgca
gtgaacacagcaaagaagcccagactctcagatgttgctcataacttgggactctctaac
acccagggatga

DBGET integrated database retrieval system