KEGG   Miniopterus natalensis: 107524928
Entry
107524928         CDS       T05883                                 

Definition
(RefSeq) late histone H2B.L4-like
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107524928
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107524928
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107524928
  09165 Substance dependence
   05034 Alcoholism
    107524928
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107524928
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107524928
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107524928
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107524928
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF DUF6246
Other DBs
NCBI-GeneID: 107524928
NCBI-ProteinID: XP_016052482
LinkDB
Position
Unknown
AA seq 173 aa
MGLCGERACVPSDSPQRCPVASPVLAPSPTWPAAANFIKSSPEEREAAVPRMSTEHGPPR
QSRGRKGRSSGKKKSRKHNRRKETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDVFER
LAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 522 nt   +upstreamnt  +downstreamnt
atggggctctgtggggagcgggcctgtgtcccttccgactctccccagcgctgcccggtg
gcgagcccagtgctggcccccagccccacctggccggctgctgctaacttcataaaaagt
agccccgaggagcgggaggcggctgtacccagaatgagcacggagcatgggccgccgcgg
cagtccaggggccggaagggccgcagttctgggaaaaagaagtccagaaagcacaaccgg
cgcaaagaaacctactcgatgtacatctacaaggtgctgaagcaggtgcaccctgacatc
ggcatctcttccaaggccatgagcatcatgaactcatttgtgaacgacgtgtttgagcgg
ctggccggcgaggccgcccggctggcccaatactcaggccgaaccacactgacgtcccgg
gaagtccagacggccgtgcgcctgctactgcctggggagctggccaagcatgctgtgtcc
gagggcaccaaggctgtcaccaagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107537073
Entry
107537073         CDS       T05883                                 

Definition
(RefSeq) histone H2B.3-like
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107537073
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107537073
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107537073
  09165 Substance dependence
   05034 Alcoholism
    107537073
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107537073
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107537073
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107537073
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107537073
SSDB
Motif
Pfam: Histone TAF
Other DBs
NCBI-GeneID: 107537073
NCBI-ProteinID: XP_016068494
LinkDB
Position
Unknown
AA seq 100 aa
MAEPASETFEELLHSESPQKIPTKIPEQEKPRGCVHPNLFEKDMFERIGEEASLLVRYNK
RSTMTSRDIQTAVRLLLPGHLGKHAVSAGTRAVLRYQLQK
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcggagcctgcctctgagacttttgaggaattgctgcattcggagagcccacagaag
atccccacaaagatcccggaacaggagaagcccaggggctgtgttcatccgaatttgttc
gaaaaggacatgttcgagcgcatcggcgaggaggcttcactcctggtccgctacaacaag
cgctccaccatgacctccagagacatccagacagccgtgcgcctgctcctgcccgggcac
ctcggcaagcatgccgtgtccgccggcaccagggctgtcctccgttaccagctacagaaa
tga

KEGG   Miniopterus natalensis: 107537075
Entry
107537075         CDS       T05883                                 

Definition
(RefSeq) histone H2B-like
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107537075
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107537075
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107537075
  09165 Substance dependence
   05034 Alcoholism
    107537075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107537075
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107537075
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107537075
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107537075
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CCDC106 TAF DUF6264
Other DBs
NCBI-GeneID: 107537075
NCBI-ProteinID: XP_016068495
LinkDB
Position
Unknown
AA seq 173 aa
MTEPSSEASVEFVGAMAEPSSEASVEFVGAVAEPSTEASEELLSTSEPTEEIPTTSKQKK
QKKQKKQKQQQKPRGRRHRPAFDSFASYFPKVLSKVHQDLSLSQQAVCVLDSFVKDMFER
IGEEASLLVHSNKRSTMTSRDIQTAVRLLLPGHLGKHAVSAGTKAVLRYQLQK
NT seq 522 nt   +upstreamnt  +downstreamnt
atgactgagccttcttctgaagcttctgtggaatttgtcggcgcaatggccgagccttcc
tctgaggcttctgtggaatttgttggcgccgtggctgagccttccactgaggcctctgag
gaactgctgagcacgagcgagcccacggaagagatcccgacgacctcaaagcagaagaag
cagaagaagcagaagaagcagaagcagcagcagaagcccaggggccgccgccaccgcccc
gccttcgacagcttcgccagctatttccccaaggttctgagtaaggttcaccaggacctg
agcctatcgcagcaggccgtgtgcgtcctggattcattcgtaaaggacatgttcgagcgc
atcggcgaggaggcttcactcctggtccactccaacaagcgctccaccatgacctccaga
gacatccagacagccgtgcgcctgctcctgcccgggcacctcggcaagcatgccgtgtcc
gccggcaccaaggctgtcctccgttaccagctacagaaatga

KEGG   Miniopterus natalensis: 107537077
Entry
107537077         CDS       T05883                                 

Definition
(RefSeq) histone H2B.3-like
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107537077
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107537077
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107537077
  09165 Substance dependence
   05034 Alcoholism
    107537077
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107537077
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107537077
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107537077
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107537077
SSDB
Motif
Pfam: Histone TAF
Other DBs
NCBI-GeneID: 107537077
NCBI-ProteinID: XP_016068496
LinkDB
Position
Unknown
AA seq 94 aa
MAEPASETFEELLHSESPQKIPTKIPEQEKPRGCVHPNLFEKDMFERIGEEASLLVRYNK
RSTMTSRDIQTAVRLLRAVGQRPHSWSSPTSAPP
NT seq 285 nt   +upstreamnt  +downstreamnt
atggcggagcctgcctctgagacttttgaggaattgctgcattcggagagcccacagaag
atccccacaaagatcccggaacaggagaagcccaggggctgtgttcatccgaatttgttc
gaaaaggacatgttcgagcgcatcggcgaggaggcttcactcctggtccgctacaacaag
cgctccaccatgacctccagagacatccagacagccgtgcgcctgctnagagcagtcggc
cagaggcctcactcctggtcctctccaacaagcgccccaccatga

KEGG   Miniopterus natalensis: 107538244
Entry
107538244         CDS       T05883                                 

Definition
(RefSeq) histone H2B subacrosomal variant-like
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107538244
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107538244
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107538244
  09165 Substance dependence
   05034 Alcoholism
    107538244
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107538244
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538244
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107538244
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107538244
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa Imm47 WASH_WAHD Endonuc-EcoRV
Other DBs
NCBI-GeneID: 107538244
NCBI-ProteinID: XP_016069914
LinkDB
Position
Unknown
AA seq 125 aa
MAKSTTKKNKCSRNRRSSRKKSHPCADFNRNYSLYIRRVLKEVDPQKSISSDTLDIMNSV
INDIFERISTQAYNLMCFRNRCTLTHEDIQKAMYMLFPGKRAKYAVTFGSEAVQRYAHSK
NNSPA
NT seq 378 nt   +upstreamnt  +downstreamnt
atggccaaatccactaccaaaaagaataagtgctccagaaaccgaagaagctccagaaag
aaatcacatccctgtgctgattttaaccgaaattattcactctacatccgcagggtcctg
aaagaagtggatccccagaaaagcatatcatctgacaccttggacatcatgaactccgtg
atcaacgacatctttgagcgcatttctacacaagcctacaatctgatgtgtttcagaaac
cgctgcaccctcacccatgaagatatccagaaggccatgtatatgctgtttcctgggaag
cgtgctaagtacgcagtgacttttggaagtgaagctgtccaaagatatgcccactccaaa
aacaactctccagcttaa

KEGG   Miniopterus natalensis: 107539107
Entry
107539107         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539107
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539107
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539107
  09165 Substance dependence
   05034 Alcoholism
    107539107
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539107
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539107
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539107
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539107
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539107
NCBI-ProteinID: XP_016070978
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggaaccggcgaaatccgctcccgcgcccaagaagggctcgaagaaagcggtcacc
aaagcccagaagaaggatggcaagaagcgcaagcgcagccggaaggagagctattccatc
tacgtgtacaaggtgctcaagcaagtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaagcatcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107539673
Entry
107539673         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539673
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539673
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539673
  09165 Substance dependence
   05034 Alcoholism
    107539673
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539673
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539673
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539673
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539673
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539673
NCBI-ProteinID: XP_016071732
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaag

KEGG   Miniopterus natalensis: 107539705
Entry
107539705         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539705
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539705
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539705
  09165 Substance dependence
   05034 Alcoholism
    107539705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539705
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539705
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539705
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539705
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539705
NCBI-ProteinID: XP_016071765
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtag

KEGG   Miniopterus natalensis: 107539706
Entry
107539706         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1-M
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539706
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539706
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539706
  09165 Substance dependence
   05034 Alcoholism
    107539706
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539706
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539706
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539706
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539706
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539706
NCBI-ProteinID: XP_016071766
LinkDB
Position
Unknown
AA seq 126 aa
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagcccactaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtag

KEGG   Miniopterus natalensis: 107539707
Entry
107539707         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539707
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539707
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539707
  09165 Substance dependence
   05034 Alcoholism
    107539707
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539707
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539707
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539707
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539707
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539707
NCBI-ProteinID: XP_016071767
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtag

KEGG   Miniopterus natalensis: 107539708
Entry
107539708         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539708
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539708
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539708
  09165 Substance dependence
   05034 Alcoholism
    107539708
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539708
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539708
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539708
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539708
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539708
NCBI-ProteinID: XP_016071768
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtag

KEGG   Miniopterus natalensis: 107539709
Entry
107539709         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539709
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539709
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539709
  09165 Substance dependence
   05034 Alcoholism
    107539709
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539709
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539709
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539709
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539709
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539709
NCBI-ProteinID: XP_016071770
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagccagcgaagtctgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtag

KEGG   Miniopterus natalensis: 107539710
Entry
107539710         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539710
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539710
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539710
  09165 Substance dependence
   05034 Alcoholism
    107539710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539710
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539710
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539710
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539710
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539710
NCBI-ProteinID: XP_016071771
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107539711
Entry
107539711         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539711
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539711
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539711
  09165 Substance dependence
   05034 Alcoholism
    107539711
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539711
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539711
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539711
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539711
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539711
NCBI-ProteinID: XP_016071772
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtag

KEGG   Miniopterus natalensis: 107539712
Entry
107539712         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539712
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539712
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539712
  09165 Substance dependence
   05034 Alcoholism
    107539712
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539712
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539712
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539712
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539712
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539712
NCBI-ProteinID: XP_016071773
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107539724
Entry
107539724         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1-A-like
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539724
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539724
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539724
  09165 Substance dependence
   05034 Alcoholism
    107539724
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539724
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539724
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539724
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539724
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CvfB_WH
Other DBs
NCBI-GeneID: 107539724
NCBI-ProteinID: XP_016071785
LinkDB
Position
Unknown
AA seq 127 aa
MPEVASKGAAISKKGFKKAVTKMQKKEGKKRKKCRKESYSIYVYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERVAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt   +upstreamnt  +downstreamnt
atgccggaggtggcttcgaagggcgccgctatttccaagaagggcttcaagaaggcggtg
acgaagatgcagaagaaggaggggaagaagcgcaagaagtgtcgcaaggagagctactcg
atttacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggcc
atgagcatcatgaactccttcgtcaccgacatcttcgaacgcgtcgcggccgaggcgtcg
cgcctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtg
cgcctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtc
accaagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107539725
Entry
107539725         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1 isoform X1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107539725
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107539725
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539725
  09165 Substance dependence
   05034 Alcoholism
    107539725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107539725
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539725
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107539725
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107539725
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107539725
NCBI-ProteinID: XP_016071786
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107542832
Entry
107542832         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107542832
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107542832
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107542832
  09165 Substance dependence
   05034 Alcoholism
    107542832
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107542832
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542832
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107542832
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542832
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107542832
NCBI-ProteinID: XP_016075780
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107542833
Entry
107542833         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107542833
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107542833
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107542833
  09165 Substance dependence
   05034 Alcoholism
    107542833
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107542833
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542833
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107542833
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542833
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107542833
NCBI-ProteinID: XP_016075781
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtag

KEGG   Miniopterus natalensis: 107542834
Entry
107542834         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1-K
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107542834
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107542834
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107542834
  09165 Substance dependence
   05034 Alcoholism
    107542834
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107542834
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542834
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107542834
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542834
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107542834
NCBI-ProteinID: XP_016075783
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagcgccaagtaa

KEGG   Miniopterus natalensis: 107542835
Entry
107542835         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1-K
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107542835
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107542835
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107542835
  09165 Substance dependence
   05034 Alcoholism
    107542835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107542835
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542835
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107542835
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542835
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107542835
NCBI-ProteinID: XP_016075784
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgccgggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagcgccaagtaa

KEGG   Miniopterus natalensis: 107542836
Entry
107542836         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107542836
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107542836
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107542836
  09165 Substance dependence
   05034 Alcoholism
    107542836
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107542836
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542836
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107542836
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542836
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107542836
NCBI-ProteinID: XP_016075785
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtag

KEGG   Miniopterus natalensis: 107542837
Entry
107542837         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107542837
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107542837
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107542837
  09165 Substance dependence
   05034 Alcoholism
    107542837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107542837
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107542837
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107542837
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107542837
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107542837
NCBI-ProteinID: XP_016075786
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107545389
Entry
107545389         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107545389
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107545389
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107545389
  09165 Substance dependence
   05034 Alcoholism
    107545389
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107545389
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545389
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107545389
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107545389
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107545389
NCBI-ProteinID: XP_016078963
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagccggccaagtccgctcccgcgcccaagaagggctcgaagaaagcggtcacc
aaagcccagaagaaggatggcaagaagcgcaagcgcagccggaaggagagctattccatc
tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaagcatcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107545391
Entry
107545391         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107545391
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107545391
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107545391
  09165 Substance dependence
   05034 Alcoholism
    107545391
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107545391
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545391
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107545391
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107545391
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 107545391
NCBI-ProteinID: XP_016078964
LinkDB
Position
Unknown
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgagccggccaagtccgctcccgcgcccaagaagggctcgaagaaagcggtcacc
aaagcccagaagaaggatggcaagaagcgcaagcgcagccggaaggagagctattccatc
tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaagcatcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtga

KEGG   Miniopterus natalensis: 107545393
Entry
107545393         CDS       T05883                                 

Definition
(RefSeq) histone H2B type 2-F
  KO
K11252  histone H2B
Organism
mna  Miniopterus natalensis
Pathway
mna04613  Neutrophil extracellular trap formation
mna05034  Alcoholism
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107545393
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107545393
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107545393
  09165 Substance dependence
   05034 Alcoholism
    107545393
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107545393
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545393
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107545393
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107545393
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 CENP-T_C
Other DBs
NCBI-GeneID: 107545393
NCBI-ProteinID: XP_016078966
LinkDB
Position
Unknown
AA seq 126 aa
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccagatcctgcgaagtctgctcccgctcccaagaagggctccaagaaagcggttacc
aaagtacagaagaaggatgggaagaagcgcaagcgcagccgaaaggagagttactccgtt
tacgtgtacaaggtgctgaaacaagttcatccggacaccgggatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgctggcgaggcctcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctctaaataa

DBGET integrated database retrieval system