KEGG   Miniopterus natalensis (Natal long-fingered bat): 107524966
Entry
107524966         CDS       T05883                                 
Symbol
MBTPS1
Name
(RefSeq) membrane-bound transcription factor site-1 protease
  KO
K08653  membrane-bound transcription factor site-1 protease [EC:3.4.21.112]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107524966 (MBTPS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107524966 (MBTPS1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107524966 (MBTPS1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.112  site-1 protease
     107524966 (MBTPS1)
Peptidases and inhibitors [BR:mna01002]
 Serine peptidases
  Family S8: subtilisin family
   107524966 (MBTPS1)
Chaperones and folding catalysts [BR:mna03110]
 Intramolecular chaperones
  Subtilisin family
   107524966 (MBTPS1)
SSDB
Motif
Pfam: Peptidase_S8 ABC_transp_aux
Other DBs
NCBI-GeneID: 107524966
NCBI-ProteinID: XP_016052532
LinkDB
Position
Unknown
AA seq 1054 aa
MTMKLVNIWLPLLVVLLCGKKHLGDRLEKRSFEKAPCPGCSHLTLKVEFSSTVVEYEYIV
AFNGYFTAKARNSFISSALKSSEINNWRIIPRNNPSSDYPSDFEVIQIKEKQRAGLLTLE
DHPNIKRVTPQRKVFRSLKYAESDPIVPCNETRWSQKWQSSRPLRRASLSLGSGFWHATG
RHSSRRLLRAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWT
NERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAIL
KKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGV
GGIDFEDNIARFSSRGMTTWELPGGYGRVKPDIVTYGAGVRGSGMKGGCRALSGTSVASP
VVAGAVTLLVSTVQKRELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSY
KPQASLSPSYIDLTECPYMWPYCSQPIYYGGMPTIVNVTILNGMGVTGRIVDKPDWQPYL
PQNGDNIEVAFSYSSVLWPWSGYLAISISVTKKAASWEGIAQGQVMITVASPAEVESKNG
AEQTSTVKLPIKVKIIPAPPRSKRVLWDQYHNLRYPPGYFPRDNLRMKNDPLDWNGDHIH
TNFRDMYQHLRSMGYFVEVLGSPFTCFDANQYGTLLMVDSEEEYFPEEVAKLRRDVDNGL
SLIVFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFSDGLYEGDF
TLASHDMYYASGCSIAKFPEDGIVITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGG
GRIVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGLAPPE
RMEGNHLHRYSKVLEAHLGGPEPRALPACPHLSWAKPQPLNETAPSNLWKHQKLLSIDLD
KVVLPNFRSNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFV
VQINKAKSRPKRRKPRVKRPQLMQQVHPPKTPSV
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgaccatgaagcttgtcaacatctggctgcctctgctagtggttttgctctgtgggaag
aaacatctgggtgacagactggaaaagagatcttttgaaaaggccccgtgtcctggctgt
tcccatctgacgttgaaggtggaattctcctcaacagttgtggaatatgaatatattgtg
gctttcaatggatactttacagccaaagctagaaattcatttatttcaagtgccctgaag
agcagtgaaataaacaactggagaattattcctcgaaataatccatccagtgactaccct
agtgattttgaggtgattcagataaaagaaaaacagagagcggggctgttaacacttgaa
gatcatccaaacatcaaacgggtaacaccccaacggaaagtctttcgttccctcaagtat
gcggagtctgaccccatagtgccctgtaatgaaactcgatggagccagaagtggcagtca
tcccgtcccctgcgaagagccagtctctccctgggctctgggttctggcatgctacagga
agacattcgagtcgacggttgctaagagccatccctcgccaggttgcccagacactgcag
gcagacgtgctttggcagatgggatatacaggtgctaatgtgagggttgctgtttttgac
actgggctgagtgagaagcatccccacttcaaaaatgtgaaggagagaaccaactggacc
aacgagcgaacgctggacgacgggctgggccacggcacttttgtggcaggtgtgatagcc
agcatgagggaatgccagggttttgctccagatgccgaactgcatattttcagggtcttc
accaacaaccaggtgtcctacacatcctggttcctggacgccttcaactacgccatctta
aagaagattgatgtgctcaacctcagcatcggtggccccgacttcatggaccatcccttc
gtcgacaaggtttgggaattaacggctaacaacgtaatcatggtttctgctattggcaat
gatgggcctctttatggcactctgaataatcctgctgatcaaatggatgtgattggagta
ggtggcattgactttgaggataacatcgcccgcttctcttcaaggggaatgactacctgg
gagctaccaggaggctatggccgtgtgaaacctgatatcgtcacctatggtgctggagtg
aggggctccggtatgaaaggggggtgccgagccctctcagggaccagcgtggcttctccg
gtggtcgctggtgctgtcaccttgctagtaagcacagtccagaaacgtgaactggtgaat
ccagcgagtatgaagcaggccctgattgcatcagcccggaggcttcctggtgtcaatatg
tttgagcaaggccatggcaagctggatctcctcagagcctaccagatcctcaacagttac
aaaccacaggcgagtttgagccccagctacatagatctgactgagtgtccctacatgtgg
ccctactgctcccagcccatctactatggaggaatgccaaccatcgtcaatgtaaccatc
ctcaacggcatgggtgtcacaggaagaattgtggacaagcctgactggcagccctatttg
ccacagaatggagacaacattgaagtggctttctcttactcctcagtgttatggccttgg
tcaggctacctggccatttccatttctgtcaccaagaaagcagcttcctgggaaggcatt
gcacaggggcaggtcatgatcactgtggcttccccagcggaggtggaatcaaaaaatggt
gcggaacagacctcaacagtgaagctcccaattaaggtgaagataattcctgctccccct
cgaagcaagagagttctttgggaccagtaccacaacctccgctacccgcctggctacttc
cccagggacaatctgagaatgaagaatgaccctttggactggaatggcgaccacatccac
accaacttcagggacatgtaccaacacttgagaagcatgggctactttgtcgaagtcctc
ggctcccccttcacgtgctttgacgctaatcagtatggaactttgctcatggtggacagt
gaagaagagtactttcccgaggaggtcgccaaactgcggcgggatgtggacaatggcctt
tcactcattgtcttcagtgattggtacaacacgtccgttatgagaaaagtcaagttttac
gatgaaaacacgaggcagtggtggatgccggacaccggaggagccaatatcccagctctg
aatgaacttctgtctgtctggaatatggggttcagcgatggcctatatgaaggggatttt
accctcgcgagccatgacatgtattatgcatccgggtgcagcatcgctaaatttccagaa
gatggcatagtgataacacagacttttaaagaccaaggattggaggttttaaagcaggaa
acagcggttgttgaaaacgtgcccattttgggactttatcagattccagctgagggtgga
ggccggattgtgttatacggagactccaattgcttagatgacagtcaccgacagaaggac
tgcttttggctcctggatgcgctccttcagtacacgtcgtatggggtgacacctcccagc
ctcagtcattctgggaaccggcagcgccctcccagcggggcgggcttggcccctccagag
aggatggaagggaaccacctgcaccggtattccaaggtcctggaggcccatttgggaggc
ccggagcctcgggctctgccggcctgtccacacctgtcctgggccaagccacagccttta
aacgagacagctcccagtaatctatggaaacatcagaagttactctccatcgacctggac
aaagtggtattacccaactttcgatcgaatcgcccccaagtgaggcccttgtctcctgga
gaaagtggtgcctgggacattcctggagggatcatgcctggccgctacaaccaggaggtg
ggccagaccatccctgtctttgccttcctgggagccatggtggtcctcgccttctttgtg
gtacaaatcaacaaggccaaaagcaggccgaagcgcaggaaacccagggtgaagcgccca
cagcttatgcagcaggttcacccaccaaagaccccttctgtgtga

DBGET integrated database retrieval system