KEGG   Miniopterus natalensis: 107525025
Entry
107525025         CDS       T05883                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna04657  IL-17 signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04672  Intestinal immune network for IgA production
mna05200  Pathways in cancer
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107525025 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107525025 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107525025 (IL5)
   04660 T cell receptor signaling pathway
    107525025 (IL5)
   04658 Th1 and Th2 cell differentiation
    107525025 (IL5)
   04657 IL-17 signaling pathway
    107525025 (IL5)
   04664 Fc epsilon RI signaling pathway
    107525025 (IL5)
   04672 Intestinal immune network for IgA production
    107525025 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525025 (IL5)
  09163 Immune disease
   05310 Asthma
    107525025 (IL5)
   05320 Autoimmune thyroid disease
    107525025 (IL5)
   05321 Inflammatory bowel disease
    107525025 (IL5)
   05330 Allograft rejection
    107525025 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107525025 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107525025 (IL5)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interleukins
   107525025 (IL5)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Cytokines
   107525025 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 107525025
NCBI-ProteinID: XP_016052601
LinkDB
Position
Unknown
AA seq 184 aa
MVSQNAINRHPLSDCWKLFISSKRDNKLVGYIILYNALSLPKSIAEHFRAMRMLLLLTFL
VLGAANICAIALESPLKRLVAETLTLLSTHRTLLTGDGNLMIPTPEHKNHQLCIKEVFQG
IDILRNQTAQGDAVEKLFQNLSSIKEYIDNEKKKCEGERLKAKKFLDYLQVFLGVINTEW
TTES
NT seq 555 nt   +upstreamnt  +downstreamnt
atggtttcacaaaacgccattaatagacaccctttatctgattgttggaaattattcatt
tcctcaaagagagacaataaattggttgggtatataatcttgtacaatgcactttctttg
cccaagtcaatcgctgaacatttcagagccatgagaatgcttctgcttctgactttcctt
gtgcttggagctgccaacatttgtgccattgccttagaaagtcccttgaaaagactggtg
gcagagaccttgaccctgctctctactcaccggactctgctgacaggcgatgggaacctg
atgattcctactcctgaacataaaaatcaccaactgtgcattaaagaagtctttcagggg
atagacatattgaggaatcaaactgcacaaggggatgccgtggagaagctcttccaaaac
ttgtcttcaataaaagaatacatagataacgaaaaaaaaaaatgtgaaggggaacgattg
aaagcaaaaaaattcctagactacctgcaagtgtttcttggtgtgataaacactgagtgg
acaacggaaagctga

DBGET integrated database retrieval system