KEGG   Miniopterus natalensis (Natal long-fingered bat): 107525144
Entry
107525144         CDS       T05883                                 
Symbol
BAG2
Name
(RefSeq) BAG family molecular chaperone regulator 2
  KO
K09556  BCL2-associated athanogene 2
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107525144 (BAG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107525144 (BAG2)
Chaperones and folding catalysts [BR:mna03110]
 Other chaperones and cochaperones
  BAG
   107525144 (BAG2)
SSDB
Motif
Pfam: ACDC PLAC9 AMP-binding_C_2
Other DBs
NCBI-GeneID: 107525144
NCBI-ProteinID: XP_016052719
LinkDB
Position
Unknown
AA seq 206 aa
MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAIEQEREILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEV
VSKFLNDLGNAKSHLMSLYSACSSEVPPGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
VENSDKAIKLLEHSKSLQQNAESRFN
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctcaggccaagatcaacgcgaaagccaacgagggccgcttctgccgctcctcctcc
atggccgaccgctccagccgcctgctggagagcctggaccagctggagctcagggtggaa
gctttaagagaagcagcaactgctatcgagcaagagagagaaatcctcctggaaatgatc
cacagtatccagaatagccaggacatgaggcagatcagcgatggagaaagagaagaatta
aatctgactgcaaaccgtttgatgggacgaaccctcactgttgaagtctcagtagaaaca
attagaaaccctcagcagcaagaatccctcaagcatgccaccaggattattgatgaggtg
gtcagtaagtttctgaatgatctgggaaatgccaagagtcacttgatgtcgctgtacagt
gcgtgttcatctgaggtgccaccagggccagttgatcagaagtttcagtccatagtaatt
ggctgtgcacttgaagatcagaagaaaattaagagacgattagagactctgcttagaaac
gttgaaaactctgacaaggccatcaagctgttagagcattctaaatctctgcaacaaaat
gctgaaagcagatttaattag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107529803
Entry
107529803         CDS       T05883                                 
Symbol
HSPA4L
Name
(RefSeq) heat shock 70 kDa protein 4L
  KO
K09485  heat shock protein 110kDa
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107529803 (HSPA4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107529803 (HSPA4L)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP110
   107529803 (HSPA4L)
SSDB
Motif
Pfam: HSP70 MreB_Mbl
Other DBs
NCBI-GeneID: 107529803
NCBI-ProteinID: XP_016058811
LinkDB
Position
Unknown
AA seq 841 aa
MSVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNV
RNTIHGFKKLHGRSFDDPIVQTERVRLPYELQKMPNGSAGIKVRYLEEERPFAIEQVTGM
LLAKLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALA
YGIYKQDLPPLDEKPRNVVFIDMGHSAYQVSICAFNKGKLKVLATTFDPYLGGRNFDEAL
VDYFCDEFKTKYKINVKENSRALLRLYQECEKLKKLMSANASDLPLNIECFMNDLDVSSK
MNRAQFEQLCVSLFARVEPPLKAVMEQSNLQREDISSIEIVGGATRIPAVKEQITKFFLK
DISTTLNADEAVARGCALQCAILSPAFKVREFSITDIVPYSITLRWKTSFEDGTGSGECE
VFSKNHPAPFSKVITFHKKEPFELEAFYTNLHEVPYPDPRIGSFTIQNVFPQSDGDSSKV
KVKVRINIHGIFSVASASVIEKQNIEGDHSDGPMETETSFKDESKDDVDKMQVDQEEGLQ
KCHAEHTPEEEIDYTGTKTKSASLDKQDRLNQTIKKGKVKSIDLPIQSSLCRQLGQDVLN
SYIENEGKMIMQDKLEKERNDAKNAVEEYVYDFRDKLGTVYEKFITQEDLNKLTAVLEDT
ENWLYEEGEDQPKQVYVDKLQELKKYGQPIQMRYMEHEERPKALADLGKKIQLVMKVIEA
YRNKDERYDHLDPAEMEKVEKYISEAMSWLNSKMNAQNKLSLTQDPVVKVSEIVAKSKEL
DNFCNPIIYKPKPKVEVAEDNTKANREHNGQMDGQSGTETKPDTTKDSSQHTKSSGEMEV
D
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgtctgtggttggcattgacctcggctttctcaactgctacatcgctgtagcgaggagc
ggcggcatcgagaccatcgccaatgaatacagcgacaggtgtaccccggcctgtatatct
ttgggatcgagaactcgagccattggaaatgcagctaagagccagatagtcacaaatgta
agaaatacaattcatggcttcaaaaagcttcatggacgatcatttgatgatcctattgtg
caaactgaaagggtcaggcttccctatgagctgcagaagatgcctaatggaagtgcagga
attaaggtgcggtacctagaagaagagagaccttttgctattgagcaagttactggaatg
cttttggctaagcttaaagagacttcagaaaatgctttgaagaagccagtggctgactgt
gtgatttcaattcctagctttttcactgatgctgagagaagatctgtgatggctgcagcc
caggtcgcaggtttaaattgtttgagattgatgaatgaaactactgcagttgcactagca
tatggaatttataaacaggatcttcccccattagatgagaaaccgagaaatgtagtcttt
attgatatgggacattctgcctaccaagtctcaatttgtgcttttaacaaaggaaaactt
aaagtcttggctactacctttgatccatatttgggtggcaggaactttgatgaggcttta
gtagactacttctgtgatgagttcaagactaagtataagataaatgtgaaagaaaactct
cgggccttgttgcgtttatatcaggaatgtgaaaaactaaagaagctaatgagtgcaaat
gcatcagatcttccactgaacattgagtgtttcatgaatgaccttgatgtttctagtaaa
atgaacagggctcaatttgaacaattatgtgtttccctctttgcccgagttgaaccacca
ttaaaagcagtaatggaacaatcaaacttacaacgtgaagacataagtagtatagaaatt
gtagggggagcaactcgaattcctgcagtgaaggaacaaatcactaaattctttcttaaa
gacataagtaccacattaaatgctgatgaagctgttgcaagaggatgtgcattacagtgt
gcaattctctcaccagcatttaaagtgcgtgagttttccataacggacattgttccctat
tcaatcacattaaggtggaagacctcttttgaggatggaactgggtctggggaatgtgaa
gtattctctaagaaccatccggccccattctcaaaagtcattactttccacaagaaggaa
ccatttgaactagaggcgttttatactaatttacatgaagtgccttatcccgatccaaga
attgggagcttcactattcagaatgtttttccacagtctgatggtgatagttccaaagtg
aaggttaaagttcgcattaacatccatggaatcttcagtgtggctagtgcatcagtaatt
gagaagcaaaatatagagggggatcacagtgatggtcctatggagacagaaacttcattt
aaggatgaaagcaaagatgatgtggataaaatgcaggttgaccaagaagaaggtctccaa
aaatgtcatgctgagcacaccccagaagaggaaattgattatacaggaaccaaaacaaag
tcagcctccttggacaaacaagaccgattaaaccagaccattaaaaaaggaaaagtcaag
agtattgatctacctatccagagcagcctgtgccgacaactgggccaagatgttcttaat
agttacattgaaaatgaggggaaaatgataatgcaagataagttggagaaagaaagaaat
gatgctaagaatgctgttgaagaatatgtgtacgattttagagacaagctgggcactgtc
tatgaaaaattcatcactcaagaagacttgaataaactgactgcagtattagaagacaca
gaaaattggctttatgaagaaggagaggaccaacccaagcaagtttatgtggataagctt
caagaactaaagaaatatggccaacctattcaaatgagatacatggaacatgaagagaga
ccaaaagctttagctgacttgggaaaaaagatccaacttgtcatgaaagtgatagaagca
tacagaaacaaggatgaaagatatgatcatttggatcctgctgaaatggaaaaagttgaa
aaatatatcagtgaagccatgagttggctgaacagtaaaatgaatgcacagaataaacta
agtctcactcaagatcctgtggtgaaagtttcagaaatagtcgcaaaatcaaaggaactg
gataatttctgtaaccccatcatttataaacccaaaccaaaagtagaggttgcagaagac
aacacaaaagctaatagggaacacaatggacagatggatggacagagtgggactgaaact
aaaccggatacaacaaaagacagctcacagcataccaaatcttctggagagatggaagtg
gactaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107537535
Entry
107537535         CDS       T05883                                 
Symbol
HSPH1
Name
(RefSeq) heat shock protein 105 kDa isoform X1
  KO
K09485  heat shock protein 110kDa
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107537535 (HSPH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107537535 (HSPH1)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP110
   107537535 (HSPH1)
SSDB
Motif
Pfam: HSP70 MreB_Mbl F-box-like_2
Other DBs
NCBI-GeneID: 107537535
NCBI-ProteinID: XP_016069062
LinkDB
Position
Unknown
AA seq 816 aa
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHA
NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPMKNGGVGIKVMYMDEEHLFSVEQITAM
LLTKLKETAENNLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALN
YGIYKPDLPGLDEKPRIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKL
VEHFCAEFKTKYKLDAKSKIRSLLRLYQECEKLKKLMSSNSTDLPLSIECFMNDQDVLGK
MNRAQFEELCAELLQKIEIPLYSLMEQTQLKVEDVSAVEIVGGTTRIPAVKEKIAKFFGK
DVSTTLNADEAVARGCALQSAILSPAFKVREFSVIDAVPFPISLVWSHDSEDTEGVHEVF
GRNHAAPFSKVLTFLRSGPFELEAFYSDPQGVPYPEAKIGRFIVQNVSAQKDGEKSRVKV
KVRVNTHGIFTISTASMVEKVPAEDSELPSVEADIECQSQRPPENPDTEANEKKVDQPPE
AKKPKIKVVNVELPVEANLVWQLGRDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVY
EFRDKLCGPYEKFICEQDHQKFLQLLTETEDWLYEEGEDQVKQAYVDKLEELMKIGTPVK
VRFQEAEERPKAFEELGQRLQHYAKIAADFRKSDEKYSHIDESEMKKVEKSVKEVMEWMN
NIMNAQGRKSLDQDPVVRAQEIKAKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNTDK
KEDDLDQGKNNFSAEPPHQNGECYPNEKSSINMDLD
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgtcggtggtggggctggacgtgggctcccagagctgctacatcgcggtggcccgggcc
gggggcattgagaccatcgccaatgaattcagcgaccggtgcaccccatcagtcatatca
tttgggtcaaaaaacagaacaattggagttgcagccaaaaatcagcaaatcactcatgca
aacaatacagtgtctaacttcaagaggtttcacggccgagcatttaatgaccccttcatt
caaaaagagaaggaaaacttaagttatgatttggttccgatgaaaaatggtggagttgga
ataaaggtaatgtacatggatgaagaacatctgtttagtgtggaacagataacagccatg
ctgttgactaagttaaaagaaactgctgaaaacaacctcaagaaaccagtaacagactgt
gttatttcagtcccctctttcttcacagatgctgagaggcgatcagtattagatgctgcg
caaattgttggtctaaattgcttaagactcatgaatgacatgacagctgttgctttgaat
tatggaatttataagcccgatctcccaggcctggatgagaaacctcggatagtggttttt
gttgatatgggacactcagcttttcaggtgtctgcctgtgcctttaacaagggaaaattg
aaggtactgggaacagcttttgatcctttcttaggaggaaaaaactttgatgaaaagtta
gtagaacatttttgtgcagaatttaaaactaagtacaagttggatgcaaaatccaaaatt
cgatcccttcttcgtctgtatcaagagtgtgagaagttgaaaaagctaatgagctccaac
agcacagacctgccactgagcattgagtgcttcatgaatgaccaggacgtgttgggaaag
atgaacagggcacaatttgaagaactctgtgctgaactcctgcaaaagatagaaattccc
ctttattcactgatggaacagactcagctcaaagtagaagatgtgagtgctgttgagata
gttggaggcactacacgaattccagctgtgaaagaaaaaattgccaaattctttggaaaa
gatgttagcacaacactcaatgcagatgaagcagttgccagaggctgtgcactgcagagt
gcaattttgtctccagcatttaaagttagagagttttctgtcatagatgcagttcctttt
ccaatatctctggtctggagccacgattcagaagacactgaaggtgttcatgaagtgttc
ggtcgaaaccatgctgctcccttctccaaagtcctcaccttcttgagaagcgggcctttt
gaactggaagctttctattctgatcctcaaggagttccatatccagaagcaaaaataggc
cgcttcatagttcagaatgtttctgcacagaaagatggagaaaaatctagagtgaaagtg
aaagtgcgagtcaacacccatggcattttcaccatctctacagcgtctatggtggagaaa
gtccctgccgaagacagtgaattgccttctgttgaagcggatatagagtgtcagagccag
agacctccagaaaacccagacactgaggcaaatgaaaagaaagttgaccagcctccagaa
gctaaaaaacccaaaatcaaggtagtgaatgtggagctgcctgttgaggccaacttggtc
tggcagctggggagagatctgcttaacatgtacatcgaaacagagggtaagatgataatg
caggataaattggagaaggaaagaaacgatgctaaaaatgcagtggaggaatatgtgtat
gagttccgggacaagctgtgtggaccatatgaaaaattcatctgtgagcaggaccatcaa
aaatttttgcagctgctcacagagactgaggactggctctatgaggaaggagaggaccaa
gtgaaacaagcctatgtggacaaactggaagaattaatgaaaattggcactccagttaaa
gttcgatttcaagaagctgaggaacggccaaaagcatttgaagaactaggccagaggctg
cagcactatgccaagatagcagccgacttcaggaagagtgatgagaaatacagtcatatt
gatgagtctgaaatgaagaaggtcgagaagtcagtgaaggaagtgatggagtggatgaat
aacatcatgaacgcccagggtagaaagagtctggaccaggatccagttgtacgtgctcag
gaaattaaagcaaaaataaaggagttgaataacacctgtgaacctgttgtaacacaaccc
aaaccaaaaattgagtcaccgaaactggaaagaactccaaatggcccaaatactgataaa
aaggaagacgatttagatcaaggcaaaaataatttcagtgctgaacctccacatcagaat
ggtgaatgttaccctaacgagaagagttccattaatatggacttggactag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107541319
Entry
107541319         CDS       T05883                                 
Symbol
HSPBP1
Name
(RefSeq) hsp70-binding protein 1
  KO
K09562  hsp70-interacting protein
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107541319 (HSPBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107541319 (HSPBP1)
Chaperones and folding catalysts [BR:mna03110]
 Other chaperones and cochaperones
  Others
   107541319 (HSPBP1)
SSDB
Motif
Pfam: Fes1 Arm HEAT_EZ Rcd1 HrpB1_HrpK CLIP_SPH_mas PPTA HEAT
Other DBs
NCBI-GeneID: 107541319
NCBI-ProteinID: XP_016073829
LinkDB
Position
Unknown
AA seq 357 aa
MADQGSGGSRLPLALPPASQGCSSGGGGSSAGGSGNPPPPRNLQGLLQMAITAGSEEPDP
PPEPMSEERRQWLQEAMSAACRGQREEVEQMKNCLRVLSQPPPPSAVEAELAMDQQEREG
ALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGPAGLRWRAAQLIGTCSQNVAAIQEQ
VLGLGALRKLLRLLDRDPCDSVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQ
VQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTD
FPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPTDDSMDR
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggcggaccaaggctcggggggcagccgcctccccctggctctgcccccggcctcccag
ggctgctcgtcagggggcggcggctcctcggcagggggctcgggcaacccgccgcccccc
cgcaacctgcaaggcctgctgcagatggccatcacggcgggctctgaggagccagacccc
ccgccagagcccatgagcgaggagcggcgccagtggctgcaggaggccatgtcggctgcc
tgccggggccagcgggaagaggtggagcagatgaagaactgccttcgagtgctgtcccag
cctccacccccctcagctgtcgaggctgagctggccatggaccagcaggagcgcgaaggg
gccctggagctgctggctgacctgtgcgaaaacatggacaatgctgcagacttctgccag
ctgtcgggcatgcacctgctggtgggccggtacctggaggcagggcccgcggggctacgg
tggcgggcggcacagctcatcggcacctgcagccagaacgtggcagccatccaggagcaa
gtgctgggtctgggcgccttgcgcaagctgctccggctgcttgaccgggacccctgtgac
tcagtgcgagtcaaggccctcttcgctatctcctgcctggtccgggagcaggaggccggg
ttgctgcagttccttcggctggacggcttctctgtgttgatgcgggccatgcagcagcag
gtgcaaaagctcaaggtcaagtcagcattcctgctgcagaacctgctggtgggccaccca
gaacacaaagggaccctgtgctccatggggatggttcagcagctagtggccctcgtccgg
acagaacacagccccttccatgagcacgtgcttggagccctgtgcagcctggtgacagac
ttcccccagggtgtgcgggagtgccgggagccagagctgggcctggaggagctccttcga
caccgctgtcagctgctgcagcagcatgaggagtaccaggaggagctggagttctgcgaa
aagctactacagacctgcttctccagcccgacggacgacagcatggatcggtga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107544865
Entry
107544865         CDS       T05883                                 
Symbol
BAG1
Name
(RefSeq) BAG family molecular chaperone regulator 1
  KO
K09555  BCL2-associated athanogene 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107544865 (BAG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107544865 (BAG1)
   04131 Membrane trafficking [BR:mna04131]
    107544865 (BAG1)
Chaperones and folding catalysts [BR:mna03110]
 Other chaperones and cochaperones
  BAG
   107544865 (BAG1)
Membrane trafficking [BR:mna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    107544865 (BAG1)
SSDB
Motif
Pfam: ubiquitin BAG Ubiquitin_5
Other DBs
NCBI-GeneID: 107544865
NCBI-ProteinID: XP_016078274
LinkDB
Position
Unknown
AA seq 422 aa
MCLLEFPYPFSGFSARPSGEGELWEIGGAWPVGLGGAERDGRVALRGCTERSSAPPAGPP
TSAGLAERGGARRPRGDRKRLGSRRRAPRPSRESRQSVPPAECGPPPSQRSSLRSAARRH
GASNRGAAAGARRPRVKKKMRAHSTRSEEVARSEEVARSEEVVGSEEVVRSEEVTESEEV
VRSEEVTENEEVVRSEEVTESEEVALSEEVAQSEEMAAAGLSVTVTHSNEKHDLHVTPQE
GCSEPIVQDLAQVVEEATGVPLPFQKLIFKGKSLKEMEKPLSALGIQNGCRVMLIGKKNS
PEEEVELKKLKDLEKSVEKIAHQLEELNKELTGIQQGFLAKDLQAEALGKLDRKVKATIE
QFMKILEEIDTLVLPENFRDSRLKRKGLVKRVQAFLAECDTVEQNIGRETEQLQSTNLAL
AK
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgtgcctattggagtttccctatcctttttccgggttttcagctcggccttcaggcgaa
ggagagctctgggagattggaggggcgtggccggttggcctgggcggggcggagcgggac
gggagagtagccctgcggggttgcaccgagcggagctcagctccccccgctgggccgcca
acaagtgcgggtctggcggagcgcggtggcgcgcggagaccgagaggcgaccggaagcgg
ctgggctcccggcggcgcgcccctcggccaagccgggagtcgcgtcagtcggtgcccccg
gccgagtgcggtccgcctccctctcagcgatcatccctccggagtgcggccagaaggcat
ggcgcatccaacaggggcgccgccgccggtgctcgcaggccgcgggtgaagaagaaaatg
cgagctcactcgacccggagcgaagaagtggccaggagcgaggaagtggcccggagcgaa
gaagtggtcgggagcgaagaagtggtccgaagcgaagaggtgaccgagagcgaagaggtg
gtccggagcgaagaggtgaccgagaacgaagaggtggtccggagcgaagaggtgacggag
agcgaagaggtagccctaagcgaagaggtggcccagagtgaggaaatggcggcggctgga
ctcagcgtgaccgtcacccacagcaatgagaagcacgaccttcatgttaccccgcaagag
ggctgtagtgaaccaattgtccaagatttggcccaggttgttgaagaggccacaggggtc
ccgctaccttttcaaaaactcatatttaagggaaaatctctgaaggaaatggagaagcca
ttgtctgcacttggaatacaaaatggttgccgggtcatgttaattgggaagaagaacagt
ccagaggaagaagttgaactaaagaaattgaaagatttggagaagtctgtggagaagata
gctcaccaactggaagagttgaataaagagcttactggaatccagcagggttttctagcc
aaagatttgcaagccgaagctcttgggaaactcgataggaaagtaaaagccacaattgag
cagtttatgaagatcttggaggagattgacacgctagttctgccagaaaatttcagagac
agtagattgaaaaggaagggtttggtcaaaagggttcaggcattccttgctgagtgcgac
acagtggagcagaacatcggccgggagactgagcagctgcaatccacaaacttggcccta
gccaaatga

DBGET integrated database retrieval system