KEGG   Miniopterus natalensis (Natal long-fingered bat): 107525387
Entry
107525387         CDS       T05883                                 
Symbol
SEC24A
Name
(RefSeq) protein transport protein Sec24A isoform X1
  KO
K14007  protein transport protein SEC24
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107525387 (SEC24A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107525387 (SEC24A)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    107525387 (SEC24A)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin TRC8_N Sen15
Other DBs
NCBI-GeneID: 107525387
NCBI-ProteinID: XP_016053029
LinkDB
Position
Unknown
AA seq 1095 aa
MSQPGIPASGGALTGLQTQNGAASASGSLYTNGPIQNALMSSQGYNSQLPESYPHLIPAK
TLNPVSGQSNYGGSHTVSPLSNYQGPGQTLHRPPMASNPVTPSLHSGPVPRMSQHTSQNP
SATPVPSGGFHPGANAPPPLNWQYNYPSTGSQTNHYPRVSTGPTMSGNTNLTSNQYVSSG
DSSLQNNFIKSGSAPPLVNPPLPTTFQPGAPLGPPPPGGPPPVRALSPQKSSHRAVPQPA
FNSPINQEGITSSTNNGSMVVHNSYDEIEGGGFLATPQLTNKNPTVNRSVGYSYPSLPPG
YQNTQPPNTAGMPPSSLNYPSGPQAFTQTPLGANNLTASMSGLSLHPEGLRVINLLHERN
MLPATPLQPPVPNLHEDIQRLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLM
QLPVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYQVNDVPEEFMYNPSTRAYGEPH
RRPEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLENLDLLPG
NTRTKIGFITFDSTIHFYSLQEGLSQPQMLIVSDIEDIFIPMPENLLVNLNESKELVQDL
LKTLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMTVFQTQLPTLGVGALKPREEPSQR
SSAKEIHLTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPS
YHHQHNPVQVQKLQKELHRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPN
VNPDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNEVFLGA
DVQAISGLLANMAVDRSVTASLSDARDALVNAVIDSLSAYRSSVLSNHQPGLMVPFSLRL
FPLFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPNLYRVDNLSDEGAL
NINDRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCGQNFLSQVLGVQSYALIP
QTMTDLPELDTPESARTIAFISWLREQRPFFPILYIIRDESPMKANFLQNMVEDRTESAF
SYYEFLLHIQQQVNK
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgtcccagccggggataccggcctccggcggcgccctaaccggcctccagacccagaat
ggggccgcctcggcctcggggtctctctacaccaacggtcctatccaaaatgcactgatg
tcttcacaaggatataattctcagcttccagaatcctatcctcatctaataccagcaaag
actttgaatccagtctctggacagtcgaactatggtggttctcatactgtttctccatta
agtaattatcagggacctgggcagactcttcatagaccacctatggcttctaatccagtg
acaccttcactccatagtggtcctgttccccgaatgtcacaacatacttctcagaaccca
tctgctacaccagtgccttctggtggctttcatcctggagccaacgcaccaccacctttg
aattggcaatataactatccatccacaggatcacagacaaaccattatcctcgtgtatca
actggaccgactatgtctgggaatacaaatctcacaagtaatcaatatgtttcctctgga
gattcttcacttcaaaacaacttcataaaatcaggttctgcaccccccttagtgaaccca
cctctgcctaccactttccaaccaggagctccgcttgggcctcctccgcctggagggcca
cctccagtgagggcccttagtcctcagaaatcatcacatagggctgtgccccagcccgca
tttaattcacctatcaaccaagaaggtattacatcaagtaccaataatggatctatggtg
gttcacaatagttatgatgaaattgaaggcggtggcttcttggcaacaccacagcttact
aataagaatcctacagtgaaccgaagtgttggatattcatatccctccttaccacctggt
tatcagaacacacaaccacctaatacagctggaatgccaccttcttccttgaactatcca
agtgggccacaggcctttacccagactcccttaggtgctaataatttaaccgcaagcatg
agtggattaagtctacatccagaagggctaagagttattaatcttcttcacgagagaaac
atgcttccagcaacacctttgcagcctccagttccaaatttgcatgaagatatccagaga
ctcaactgtaacccagagttatttcgatgcacattgactagcattcctcagactcaggcc
ttactgaataaagccaaacttcctttgggactgctgcttcatcctttcaaagacctaatg
caattgcctgtggttacctccagtacaattgtgagatgccgttcatgcaggacatacatc
aacccttttgtcagctttcttgatcaaaggagatggaagtgtaacttatgttaccaagtc
aatgatgttcccgaagaattcatgtacaacccttcaaccagagcctatggagaacctcac
agaagacctgaagttcagaatgctacaattgagtttatggctccttcagaatacatgtta
cggccacctcaacctccagtgtacctctttgtatttgatgtgtctcacaatgcagttgaa
actggatacttgaattcagtttgccagagtttgctagagaatctggatttgcttcctggc
aacactaggacaaaaattggcttcataacatttgatagtacaatccacttctacagtctt
caagaaggtctctctcaacctcagatgctaatagtttcagatattgaagatatttttata
cctatgccagagaacctattagtaaatttaaatgaaagtaaagagcttgtccaagattta
ctgaaaactttgccacaaatgttcaccaagaccctggagacccagagtgccttgggtcct
gcacttcaggctgcctttaagctgatgtccccaactggtggtcgaatgactgtctttcaa
acacaactcccaactcttggggtgggagctctgaaaccacgagaggaacccagccaaagg
tcatctgctaaggaaattcacttaacgccatccactgacttctataagaaattagccttg
gactgttctggtcagcaggtagctgttgatctgttccttcttagtggacagtattcggat
ctggcttctctgggttgtatttctcggtattcagcgggtagtgtctattactatccctct
taccaccaccagcacaacccagtccaggtacagaaattacagaaggagctacacagatac
ctcacccggaagattggctttgaggcagtcatgaggattcggtgcactaaaggtctttcc
attcatactttccatgggaacttctttgttcggtctacagacttactgtctttgcccaat
gtaaacccagatgctggatatgcagtacagatgtcagtggaagagagtcttactgacact
caattggtttcttttcagtcagcacttttgtatacgtccagcaaaggtgaaagaagaatt
cgtgttcatactttgtgtttaccagtagtttcaactctgaatgaagtctttcttggagct
gatgttcaagcaatttcagggttattagccaatatggctgttgacagatctgtgactgcc
agtctgagtgatgcccgggatgccctggtgaacgctgtcatagactcactctcagcttat
cgttcatcagtcctaagtaaccaccagcctggactcatggttcctttttctttgagactt
tttccactctttgtgttggctctccttaaacagaaatcattccagactgggacaaatgct
cgtctagatgaacgcatttttgctatgtgtcaagtgaaaaaccagcccttggtttacctt
atgctcacaactcatcccaatttgtatagagttgacaatctttcagatgagggagcactc
aacatcaatgatcgaactatacctcagccgcctattcttcagctttcagtggagaaactg
agcagggatggagcttttctcatggatgcaggctctgtactgatgctttgggttggaaaa
aattgtggacagaattttctcagtcaagttctaggagttcaaagctatgcattaattcca
cagaccatgacagaccttccggaacttgatacaccagaatctgccagaacaatagctttc
atctcttggctcagagaacaaagaccattcttcccaatactttatataataagggatgag
agtccaatgaaagcaaatttccttcaaaacatggtagaagacagaacagaatctgcattt
tcatattatgaattcctcttgcatatacaacagcaagtgaataaatga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107527847
Entry
107527847         CDS       T05883                                 
Symbol
SEC24D
Name
(RefSeq) protein transport protein Sec24D isoform X1
  KO
K14007  protein transport protein SEC24
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107527847 (SEC24D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107527847 (SEC24D)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    107527847 (SEC24D)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin
Other DBs
NCBI-GeneID: 107527847
NCBI-ProteinID: XP_016056194
LinkDB
Position
Unknown
AA seq 1049 aa
MALSDSAPLANIIFSSVTGLFCRTISWNDIFIMSQQGYVATPPYSQSQSGMGLSAPHYGH
YGDPSHTGAPPGMMKPAGPLGAAPGGMLPQGPPPPGSHQFGQNGAHAQGHPPQRFPGPPP
VNSGAPSYAPYSPATQSSYPSPASTSSISQLGSQLNTMHISSYGSGMAPPGQGPPGSLSA
PSCQGPPRPPQPSILQPGSQILPPPPTALNGPGVPPLPPNPQLQPPPLPGQTLGTGYPPQ
QANYGPQMPGAQLGYPGGFPGGPAQMTGPPPPQRKLDPDSVPSPIQVIENDRATRGGQVY
ATSTRGQVPPLVTTDCVVQDQGNASPRYIRCTTYCFPCTSDMAKQAQIPLAAVITPFATV
PSNETPLYLVNHGETGPVRCNRCKAYMCPFMQFIEGGRRFQCGFCSCVNEVPPSYFQHLD
HVGRRLDHYEKPELSLGSYEYVATLDYCRNNKPPNPPAFIFMIDVSYSNIKSGLVRLICE
ELKTVLDRLPKEEQEETSAVRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLD
GFLVNYQESQSVIHNLLDQIPEMFADSNENETVFAPVIQAGMEALKAADCPGKLFLFHSS
LPTAEAPGKLRNRDDKKLINTDKEKILFQPQTNVYDSLARDCVSHGCCVTLFLFPSQYVD
VASLGLVPQLTGGTLYKYNNFQMHLDSQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATD
FFGGIIMNNTTDVEMAAIDCDKAVTVEFKHDDKLGEDSGALIQCAVLYTTIGGQRRLRIH
NLALSCSSQLADLYKSCETDALINFFAKSAFKAVLHQPLKLIREILVNQTSHMLACYRKN
CASPSAASQLILPDSMKVLPVYMNSLLKNCVLLSRPEIPTDERAYQRQLVMTMGVADSQL
FFYPQLLPIHTVDVKSTAVPAAIRCSESRLSEEGIFLLSNGLNMFLWLGVSSPPELIQGI
FSVPSLAHVNTDMTVLPEVGTPYSQTLRTIMGILQHKRPYSMKLVIVKQREQPEMAFRQL
LVEDKGLDGGPSYVDFLCCVHKGVCQLLN
NT seq 3150 nt   +upstreamnt  +downstreamnt
atggcattaagtgactcagctcctcttgctaacatcattttctcttctgttacagggctc
ttttgtagaactatctcttggaatgatattttcataatgagtcaacaaggttatgtggcg
acacccccctattctcagtctcagtctgggatgggcctttctgcaccgcattatggccac
tatggggacccatctcacacaggcgctccaccaggtatgatgaagccagcagggcctttg
ggggctgcacccgggggcatgttgcctcagggccccccacctcctgggtcccatcaattt
ggccagaatggagctcatgcccagggtcatcctccccaaagatttccaggtcctccacct
gtcaacagtggggcaccctcctatgccccatattcacccgctacacagtcatcatatcca
agtcctgcgtccacttcatccatctcccagctgggcagccagctcaacaccatgcacatc
agcagctatggttcgggcatggctcctcccggccaggggcccccaggctccctgtctgca
ccttcgtgccagggtcctccacgccctccacagccatctattttgcagcctgggtctcag
attctcccaccacctcccactgcactaaacggccctggtgtaccacccttgcctcctaat
ccccagctgcagcctccgcctcttccaggacagaccctgggcaccggatacccaccacag
caggccaactatggcccccagatgcctggtgcgcagctcgggtacccaggaggcttcccc
ggagggcctgcgcagatgactggtccacccccaccccagaggaagctggatcctgactct
gtgcccagcccaatccaggtgattgagaatgaccgagccaccagagggggacaggtctat
gccaccagcaccagaggccaggtccctcccctggtcaccacagactgcgtggtacaagat
caaggcaatgccagtcctcggtacatccgctgcacaacatactgtttcccttgcacgtca
gacatggccaagcaggctcagatccccttagccgctgtcatcacgcccttcgccacagtt
ccttcaaacgagactcccctttacctggtgaaccacggagagactggcccagtgaggtgc
aaccgctgcaaagcctacatgtgccccttcatgcaattcattgagggtggcaggcgcttc
cagtgtgggttctgcagctgcgtgaatgaagtcccgccatcctatttccaacatctggac
cacgttggcagaagactggaccactacgagaagccggagctgtctctaggatcttacgag
tacgttgctactttggattactgcagaaacaataagcctcccaacccaccagccttcatc
ttcatgatcgacgtttcctacagtaacatcaagagtgggctcgtgaggctcatctgtgaa
gaactgaagactgtgctggacagactgcccaaggaagagcaagaagagacttctgcggtt
cgtgttgggttcatcacctataacaaagtcctccatttctttaatgtcaagagtaatttg
gcgcagcctcagatgatggtggtgaccgacgtgggcgaggtctttgtccctttgttggat
gggtttcttgtcaactatcaagagtcccagtctgtgattcacaatttattggaccagatc
ccggagatgttcgccgactctaatgagaatgagaccgtctttgcacctgtcattcaggcc
ggcatggaagccctgaaggctgcagactgtcccggaaagctgttcctcttccactcctcc
ctgcccacagcggaagcccctgggaagctcaggaacagggatgataagaagctgatcaac
acagacaaagagaagatccttttccagccccaaaccaatgtttacgactcgctggccagg
gactgcgtgtcccacggctgctgtgtgacactcttcctctttcccagccagtacgtggac
gtggcctccttgggcctcgtgccccagctcacaggaggaactctttacaaatacaacaac
ttccagatgcacttggatagccaacaatttttgaatgacctcagaaatgatattgaaaag
aaaataggatttgatgctataatgagggtccgaaccagcacaggtttcagagccactgac
ttctttggtgggattattatgaacaacaccaccgatgtggagatggcagccatcgactgt
gacaaggcggtgacggtggagttcaagcacgatgacaagctcggtgaagacagcggggcc
ctgatccagtgtgctgtgctctacaccaccattggggggcagaggagactgcgcattcac
aacctggccctgagctgcagctctcagctagccgacctctacaagagctgcgagacagac
gctctcatcaacttcttcgccaagtcagcttttaaagcagttctgcatcaacccttgaag
ctcatccgggagattctagtgaaccagacctctcacatgctggcctgctaccggaagaac
tgtgcaagcccatccgcagccagccagctcattttgccggattccatgaaagtccttcca
gtgtacatgaactctttgttgaaaaactgtgtgctgctcagcagacccgagatcccgaca
gacgagcgggcgtaccagagacagctggtcatgaccatgggtgtggctgactcgcagctc
ttcttctacccgcagctcctgcccatacacacggtagatgtcaagagcacagcagtgcct
gccgccattcgctgctctgagtcccgtctttcagaagaaggaatcttcctcctctctaat
ggtctgaacatgttcctgtggttgggagtcagcagcccaccagaactcatccagggaata
ttcagcgtgccgtctctggcacatgtcaacaccgatatgacagtgctgccggaggtggga
accccttactctcaaacactcaggacgatcatgggcatcctccagcataagaggccgtac
tcaatgaagctcgtgattgtgaagcagcgagaacagccggagatggctttccggcagctc
ctggtggaggacaaggggctggacggagggccgtcctacgtggacttcctgtgctgcgtg
cacaagggcgtctgccagctgctgaactga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107534371
Entry
107534371         CDS       T05883                                 
Symbol
SEC24B
Name
(RefSeq) protein transport protein Sec24B
  KO
K14007  protein transport protein SEC24
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107534371 (SEC24B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107534371 (SEC24B)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    107534371 (SEC24B)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin Sen15
Other DBs
NCBI-GeneID: 107534371
NCBI-ProteinID: XP_016064945
LinkDB
Position
Unknown
AA seq 1391 aa
MGCRGRDCLRNVTPRPETAGGLEEEPGAGPHPSDLAGARRVASSDPCARHPTRSRGRRVC
GLGKTGFGLEVCHCFCGCRSRGWSWFVVVFEREQVSNGFKRIPLDWVVFLLPAALHFQKF
KNVLELACFEARPPYRQRPVQRESRFHSQGLQAVSVQEFQKLVLLLPVPVNICFSFSGPA
QNQMQVPSGYGLYPQNYSAPSGHYSQGSGKMTSLPLDGQCGNYYSGLYTVPTQSVVTPKT
TNQQPGAQQIYGRGPPAPHTVGSTPEYFQGATSSASHLHTSASLPYSSFVNHYSTPAMYS
ANSSAVSQGFPSTCGHYAVSTVSNAAYPSVSYPSLPAGEPYGQQMFTSQNASTIRPVREN
SFSSQNTTLSHPSPLPPPPSQQYHQQQSVSGYSTPSWSASGPPSTQDNLRNHIGSLATAN
NHPTNTDSLSYPVMQNVQHPKSNPVVSTVVSGASSARSPLVANHLVEPVASVTQPSELLQ
QKGMQYGEYVNNQASSAPTPLSSTSDDEEEEEEDEEAGIDSSSTTSSASPLPNSYDALEG
GSYPDMLSSSASSPAPDPAPETDHTPAPVPTAPQPSKVAKPFGYGYPTLQPGYQNAAAPL
NPGGQPGNPAYSGFQQYAQQYPGMNQLSSSLGGLSLQSSVIPESLRPVNLTQERNILPMT
PVLPPVPNLNLDLKKLNCSPDSFRCTLTNIPQTQVLLNKAKLPLGLLLHPFRDLTQLPVI
TSNTIVRCRSCRTYINPFVSFIDQRRWKCNLCYRVNDVPEEFMYNPLTRSYGEPHKRPEV
QNSTVEFIASSDYMLRPPQPAVYLFVLDVSHNAVEAGYLTVLCQSLLENLDKLPGDSRTR
IGFVTFDSTIHFYNLQEGLSQPQMLIVSDIDDVFLPTPDSLLVNLHESKELIKDLLNALP
NMFTNTRETHSALGPALQAAFKLMSPTGGRVSVFQTQLPSLGAGLLQSREDPNQRSSTKV
VQHLGPATDFYKKLALDCSGQQTAVDLFLLSSQYSDLSSLACMSKYSAGCIYYYPSFHYT
HNPSQAEKLQKELKRYLTRKIGFEAVMRIRCTKGLSMHTFHGNFFVRSTDLLSLANINPD
AGFAVQLSIEESLTDTSLVCFQTALLYTSSKGERRIRVHTLCLPVVSSLADVYAGVDVQA
AICLLANMAVDRSISTSLSDARDALVNAVVDSLSAYGSTVSNLQHSVLIAPSSLKLFPLY
VLALLKQKAFRTGTSTRLDDRVYAMCQIKCQPLAHLMRMIHPNLYRIDRLIDEGAIHVND
RVVPQPPLQKLSAEKLTREGAFLMDCGSVFYIWVGKSCDNHFIEDVLGYPDFASIPQKMT
HLPELDTLSSERARSFITWLRDSRPLSPVLHVVKDESPAKTEFFQHLIEDRTEAAFSYYE
FLLHIQQQICK
NT seq 4176 nt   +upstreamnt  +downstreamnt
atgggatgccggggccgggactgtttgcgtaatgtgacccccaggcccgaaaccgccggg
ggcctggaggaggagccgggtgcgggcccccatccctcagatctcgccggggcgcggcga
gtggcctcgagcgacccctgcgcgagacaccccaccaggagccgaggccgccgagtgtgc
ggtctggggaagactgggttcggcctcgaggtctgtcattgcttctgcggctgccgctcc
agaggttggagttggttcgtcgtcgtgtttgaaagggagcaggtgtcaaacgggtttaaa
cgaatccctttagattgggtggttttcctcctcccagctgcacttcactttcagaaattc
aaaaacgtgctagagttggcctgcttcgaggccaggcctccttacaggcagcggccagtg
cagcgcgaaagccgctttcactctcaaggtcttcaggcggtgagtgtgcaggagtttcag
aaattagttctcctcttgccagttcctgtaaatatttgcttttctttttcaggtccagca
cagaatcaaatgcaggttccatctgggtatggattgtatcctcaaaactatagtgctccc
tcgggacattactctcaaggatctgggaaaatgacctcattgccattggatggccagtgt
ggcaattactactctggtctctatacagtaccaacacaaagtgtggtgactcctaaaaca
acaaaccaacaaccaggagcacagcagatatatggcaggggtcctcctgcccctcacact
gtggggtccactccagaatatttccaaggtgccacatcatcagcatctcatttgcatacg
agtgcctccttgccatactcctcttttgtgaatcattacagtactccagccatgtactct
gccaactcttctgctgtttctcagggatttccctctacttgtggtcactatgctgtgtca
actgtttctaatgctgcgtatcctagtgtttcatatccctctctgcctgctggtgagcca
tatgggcaacaaatgtttacctcacagaatgcttcaactatcaggccagttagagagaat
tcattttctagtcaaaataccactctcagccatccatcaccacttccacctccaccatca
caacagtaccaccagcagcagagtgtttcaggatacagtacgccctcgtggtcagcttca
ggccctccatcaactcaagacaatctccgaaaccacattggctccctggctacagccaac
aaccacccaacaaataccgattctttatcctatcctgttatgcaaaatgttcagcatccc
aagtctaacccagtggtatccactgttgtatcaggagcctcgtcagcaaggtcacctctt
gttgcaaatcacctcgttgagcctgtcgcctcggttacacagccatcagaactgttacaa
cagaaaggcatgcagtatggtgaatatgttaataatcaagctagctccgcaccaactccc
ttgtcatcaacttccgatgatgaggaagaggaggaggaggatgaggaagcaggtattgac
agctcttccaccacaagcagtgcttctccactgcccaacagttatgatgccctagaagga
ggcagctacccagatatgctttcttcatcagcaagcagtcccgctcctgaccctgctcct
gaaactgaccatactccagctccagtacccactgcccctcagccttcaaaagtggctaaa
ccgtttggatatggttatcccactcttcagcctggttatcagaatgctgcagcaccactg
aatcctggaggacagcctggtaacccagcgtattctggattccagcagtatgctcaacag
tatcctggtatgaaccagctgtcctccagtctgggaggactgagtctccagagttctgta
ataccagaaagcctaagacctgtcaacctcactcaggagaggaatatcttacccatgact
cctgttttgcctcctgtacctaacttgaatttagacctcaaaaaattaaactgtagccca
gattcctttcggtgtactttgacaaatattccacagacacaggttttactgaataaagct
aagcttcctttaggattgttgttacatcccttcagagacctaacgcaattacccgtgata
acatcaaataccattgtgaggtgccgatcttgtcgaacatatatcaacccttttgtgtcc
ttcattgatcagcgtagatggaaatgcaatttgtgctatagagtcaatgatgttcctgaa
gaatttatgtataaccctcttacccgatcttacggagagcctcataaacggccagaagtt
cagaattcaaccgtggagttcattgcttcttctgattacatgcttcgtcctcctcagcct
gcagtttacttgtttgttttagatgtgtctcataacgcagtggaagctgggtatttgaca
gttttgtgccagtcactgttagaaaatctagacaagcttcctggagattcacgaacaaga
ataggatttgtcacctttgatagcactattcatttctacaatttacaagaaggattatcg
cagcctcagatgttgattgtatctgatatagatgatgtttttctacctactccggatagc
ttacttgtgaacctacacgaaagtaaagagcttataaaagacttattgaatgcattacca
aatatgttcaccaatacaagagaaacacacagtgcccttggtcctgcgcttcaggctgcc
tttaaattaatgtctccaacaggtggccgtgtgtctgtatttcagacacagttaccttcc
ttgggtgcaggacttctgcagtccagagaggatcctaatcagagatcgagcacaaaggtt
gtacaacatcttggccccgcaactgatttttataagaaactcgctttagattgctcaggg
cagcagactgcagtggatctgttccttttaagttcacagtattctgatctttcttctcta
gcttgcatgtccaagtattcagcggggtgcatctattattatccatctttccattatact
cacaatccttcacaagcagaaaagttacaaaaagaactaaaacgttatctcacaaggaaa
attggatttgaagctgttatgagaataaggtgtactaaaggtctttcaatgcatactttt
catggaaacttctttgttcgttccactgatttgttatccctcgccaacatcaatcccgat
gctggatttgcagtacagctgtccattgaagaaagtttgacagacacttccttggtgtgc
tttcaaacagccctgttatatacatcaagcaaaggtgagcgaagaattagagtgcataca
ctttgtttgccagtggtgagttcactagcagatgtatatgcaggagtagatgtacaagct
gccatctgccttctggcaaacatggctgtggatcgatccatttcaacaagtctctcagat
gcaagagatgccttagtgaatgctgtggtggattcattgtccgcatatggctcaactgtc
tcaaatttacagcactcggtgctgattgcacccagctctctcaagttgtttcctctctat
gttttggcccttctcaaacagaaagcctttagaaccggtacaagcacacgcctggatgat
cgtgtgtatgccatgtgtcagataaagtgtcagccacttgctcatctaatgagaatgatt
catcccaacttatacaggatagacagattgatagatgagggtgcaatacatgttaatgac
agggtcgtaccccagccacctcttcagaaattgtctgcagagaagctgacaagagaaggt
gctttccttatggactgtggctctgttttttacatttgggttggaaaaagctgtgacaac
cacttcatagaggatgtgcttgggtatcctgattttgcgtcaataccacagaaaatgaca
catcttccagagttagatacgctttcatcagaaagagccagatcctttataacttggctt
agagacagcagaccattaagccctgttcttcacgtggtaaaagatgagagtcctgccaaa
acagaattttttcaacatttgattgaagaccgtacagaagccgcgttctcttactatgaa
ttcttgcttcacattcagcagcagatttgtaagtga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107534632
Entry
107534632         CDS       T05883                                 
Symbol
SEC23A
Name
(RefSeq) protein transport protein Sec23A
  KO
K14006  protein transport protein SEC23
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107534632 (SEC23A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107534632 (SEC23A)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    107534632 (SEC23A)
SSDB
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical zf-Sec23_Sec24 Gelsolin APP_E2
Other DBs
NCBI-GeneID: 107534632
NCBI-ProteinID: XP_016065281
LinkDB
Position
Unknown
AA seq 765 aa
MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL
CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISELNQPAELLPQFSSIEYV
VLRGPQMPLIFLYVVDTCMEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLSAKQLQEMLGLSKVPVTQATRGPQVQQPPPSNRFLQPVQKIDMNL
TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM
VVGDELKTPIRSWHDIEKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM
KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDIHGQFKMGFGGTLEIKTSREIKISGAI
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLAIYFEVVNQHNAPIPQGGRGAVQ
FVTQYQHSSGQRRIRVTTIARNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGP
DVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFHLRRSPFLQVFNNSPDES
SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPVLLDSSSILADRILLMDTFFQILIYH
GETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgacaacctatttggaattcatacaacaaaatgaagaacgagatggagtccggtttagt
tggaatgtttggccatcaagtcgactagaagctacaagaatggttgttccagtagcagcc
ctatttacaccactgaaggagagacccgatttaccgcctattcaatatgaacctgttttg
tgtagtaggaccacttgccgtgcagttttgaatcctttatgtcaagtggattatcgagca
aaactctgggcttgcaacttttgttatcaaaggaatcagtttccacctacttatgctggt
atatcggaactgaatcagcctgctgaacttttacctcagttttctagcatcgaatatgta
gttctgcgtggtcctcagatgcctttgatattcctctatgtggttgatacttgcatggaa
gatgaagatttacaagctctgaaggaatctatgcagatgtcattaagtcttttaccacct
acagccttggttggacttattacttttgggagaatggtgcaggttcatgaacttggatgt
gagggcatttcaaaaagttatgtcttcagaggaacaaaagatctgtctgccaaacaactg
caggaaatgctggggctctctaaagtacccgttactcaagcaacacgtggtcctcaggta
cagcagccacctccttccaatagattcttgcagccagtacagaaaatagacatgaatctc
acagatcttctgggggaactgcagcgagacccttggcctgtaccacagggaaaaagacct
ttgcgttcctctggggtggcactttccatagctgtaggactacttgagtgtacttttccc
aacactggtgcccgaatcatgatgttcattggcggtccagccactcaggggccaggaatg
gtggttggagatgaattgaagacacctataagatcatggcatgacattgaaaaagacaat
gccaaatatgttaaaaagggaactaagcattttgaagcattggctaatcgagctgccaca
actggtcatgttattgatatctatgcatgcgcattagatcagacaggtctcctggagatg
aaatgctgtcccaaccttactggaggatacatggtaatgggcgactctttcaacacttct
ttattcaagcaaacttttcaaagagtcttcaccaaagatatacatggacagtttaaaatg
ggttttggtggtacattagaaataaagacctcaagggaaataaagatttcaggagctatt
ggaccctgtgtgtctctcaattctaaaggaccctgtgtgtctgaaaatgagataggaaca
ggtggcacttgtcaatggaagatatgtggtcttagtcccactacaaccttagccatatat
tttgaggttgtcaatcagcataatgctccaattcctcaaggagggcgtggcgcagttcag
tttgtgactcagtatcagcattcaagcgggcagagacgcatccgagtgaccaccattgcg
aggaattgggcagatgctcaaactcaaatccaaaacattgctgcatcttttgaccaggag
gctgctgccattcttatggccaggctggcaatatatagagcagaaaccgaggaagggcca
gatgtgcttagatggctagacagacagctcattcgactgtgtcagaaatttggagagtat
cacaaagatgacccaagttccttcagattttcagaaactttctccctttatccacagttt
atgtttcacttaagaaggtctcctttcttgcaagtttttaacaatagccctgatgagagt
tcatattatcgtcaccatttcatgcgtcaagatctgacccagtctctgatcatgattcaa
cctattctgtatgcatattcttttagtggaccaccagagccggttcttctcgatagcagc
agcattctcgcagatcgtattcttctcatggacacattcttccagattttgatttatcat
ggcgagaccatagcccagtggcgcaagtcaggataccaggacatgccagaatatgaaaat
ttccgccaccttctgcaagccccagtggatgacgcccaggagattcttcactccagattt
ccaatgccaagatacatcgacactgaacatgggggcagccaggcccgttttctgctttca
aaagtcaacccttcacagactcataataatatgtatgcctggggacaggagtctggagca
cctattctcacagatgatgttagtctgcaagtgttcatggaccatttgaagaaacttgct
gtgtcaagtgctgcttga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107536332
Entry
107536332         CDS       T05883                                 
Symbol
SEC23B
Name
(RefSeq) protein transport protein Sec23B
  KO
K14006  protein transport protein SEC23
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107536332 (SEC23B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107536332 (SEC23B)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    107536332 (SEC23B)
SSDB
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical zf-Sec23_Sec24 Gelsolin APP_E2
Other DBs
NCBI-GeneID: 107536332
NCBI-ProteinID: XP_016067464
LinkDB
Position
Unknown
AA seq 767 aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAILNPLCQVDYRAKLWACNFCFQRNQFPPAYTGISEVNQPAELMPQFSTIEYV
IQRGPQSPLVFLYVVDTCLEEEDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFVSSRFLQPVHKIDM
NLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP
GMVVGDELKVPIRSWHDIEKDNARFMKKATKHYEMLANRTATNGHCIDIYACALDQTGLL
EMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFSKDFNGDFRMAFGATLEVKTSRELKVAG
AVGPCVSLNVKGSCVSENEVGVGGTSQWKICGLDATTTLGIYFEVVNQHNAPIPQGGRGA
IQFVTQYQHSSTQRRLRVTTIARNWADAQSQFKHIEAAFDQEAAAVLMARLGVFRAELED
GPDILRWLDRQLIRLCQKFGQYNKDDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETVAQWRKAGYQDMPEYESFRHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFL
LSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAS
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggcaacatatctggagttcattcagcagaatgaagaacgggatggtgtgcgtttcagt
tggaatgtgtggccttccagccgtctcgaggctacaagaatggtggttcctctggcttgt
ctccttacgcctttgaaagaacgtccagacctgccccctgtacagtatgaacctgtgctc
tgcagcagaccaacttgcaaagccattctcaacccactttgtcaggttgattatcgggca
aaactttgggcctgtaatttctgtttccaaagaaaccagtttcctccagcttatacaggc
atatctgaggtgaatcagcctgctgaattgatgccccagttttctacaattgagtacgtg
atacagcgaggtccacagtctcctctagtcttcctttacgtggtcgacacgtgcctggaa
gaagaggaccttcaagcactcaaagaatctctacaaatgtctctgagtctccttcctcca
gatgctctggtgggtttgatcacgttcgggaggatggtgcaggttcacgaactcagctgt
gaaggaatctccaaaagttatgttttccgagggaccaaggatttaactgcaaagcagata
caggatatgcttggcctgaccaagcctgccatgcccatgcagcaagcaagacctgctcaa
ccacaagagcacccttttgtttcgagcaggtttctgcagcctgttcacaagattgacatg
aacctcactgaccttcttggggagctgcagagggacccgtggcccgtaactcaggggaag
agacctttgcgatccactggtgttgctttgtctattgctgttggcttgttggagggcact
tttccgaacacgggagccaggattatgttgtttacaggtggtcctcccacccaagggcct
ggaatggtggttggagatgaattaaaggttcctattcgttcctggcatgatattgagaaa
gataatgcacgtttcatgaagaaagcaaccaagcactatgaaatgcttgctaatcgaact
gctacaaatggccactgcatcgatatttatgcttgtgcccttgatcaaactggacttttg
gagatgaaatgctgtgccaatcttaccggaggctacatggtcatgggagattcttttaac
acatcacttttcaagcagacattccaaagaatttttagtaaagattttaatggagatttc
cgaatggcatttggtgctactttagaagtaaagacctctcgggaactgaaggttgcagga
gccgttggtccttgtgtatctctgaatgtgaaaggatcgtgtgtgtcagaaaatgaggtt
ggtgtcggtggcacgagtcagtggaaaatctgtggtctggatgccacaactacacttggc
atctactttgaagtagtcaatcagcacaatgccccgatcccccaaggaggccgcggcgcc
atccagtttgtcacgcagtatcaacactccagcacccagagacgcctccgtgtgaccacc
attgcccgaaattgggcagatgcacagagtcagttcaagcacatagaagcagcatttgac
caagaggccgcagcagtcttgatggcacggctgggagtgttccgagcagagttagaagat
gggcctgatatactccggtggctggaccgacaactcattcgactgtgtcagaagtttggg
cagtataacaaggatgatcctacctcttttaggctatcggattccttctctctgtatcct
cagttcatgttccatcttagaagatctccgtttcttcaagtgtttaacaacagtcccgac
gaatcgtcgtattacagacaccattttgcccgacaggatttgacccagtctctcatcatg
atccagcccattctctactcctattcattccatggaccaccagagccagtactgttggac
agcagcagcattctagctgacagaattttgttgatggatactttcttccaaattgtcatt
tatcttggtgagaccgtagcccagtggcgtaaagctgggtaccaggacatgcctgagtat
gaaagcttcaggcaccttctgcaggcaccactggatgatgctcaggaaattcttcaagca
cgcttcccaatgccccgctacattaacacagagcatgggggcagtcaggctcgattcctt
ttgtccaaagtgaatccatctcagacacacaataacctgtatgcttggggacaggaaacg
ggagcacccatcctaactgacgacgttagcttgcaggtgttcatggatcatttgaagaag
ctggctgtctccagtgcctcttaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545835
Entry
107545835         CDS       T05883                                 
Symbol
SEC24C
Name
(RefSeq) protein transport protein Sec24C
  KO
K14007  protein transport protein SEC24
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545835 (SEC24C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107545835 (SEC24C)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    107545835 (SEC24C)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin
Other DBs
NCBI-GeneID: 107545835
NCBI-ProteinID: XP_016079578
LinkDB
Position
Unknown
AA seq 1096 aa
MNVNQSAPPVPPFGQPQPVYPGYHQSSYGGQPGSTAPPNSYGAYNGPVPGYQQAPPPGMS
RAPPSSGAPPASTAQASCGQGAYGQFGQGDVQNGPSSTVQMQRLPGSQPFGSAPLAPVVS
QPTVLQPYGPPPTSAQVTAQLAGMQISGAATPAPPPSGLGYGPPTSLASASGSFPNSGLY
GSYPQGQAPPLSQAQGHSGAQPPQRSAPQQASSFTPQASGGPRMPSMTGPPLSGQSFGGP
PVNQPNHVSSPPPQTLHPGTQMAGPPGPPPPMHSSQQPGYQLQQNGSFGPPRGPQPNYGS
PYPGAPTFGNQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGSEPFVTGVRGQVPPLVT
TNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHG
ESGPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPE
LSLGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRSGLVRLLCEELKSLLDFLPRES
GAEESAIRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVI
TSLLDQIPEMFADTRETETVFAPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNR
DDRKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGG
SVYKYACFQVENDQERFMSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDV
ELAGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADL
YRNCETDTLINYMAKFAYRGVLNSPVKTVRDTLITQCAQILACYRKNCASPSSAGQLILP
ECMKLLPVYLNCVLKSDVLQPGAEVTTDDRAYVRQLVTSMDVAETNVFFYPRLLPLTKSP
IESTTEPPAIRASEERLSNGDIYLLENGLNLFIWVGAGVQQGVVQSLFSVSSFSQITSGL
SILPVLDNPLSKKVRGLIDSLRAQRSRYMKLIVVKQEDKLEMLFKHFLVEDKSLSGGASY
VDFLCHMHKEIRQLLS
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgaacgtcaaccagtcagctccacctgtgccaccgtttgggcagccccagcctgtctac
ccagggtatcatcaatccagctatggtgggcaaccagggtccacagcccctcccaactca
tatggagcctacaatgggccagtaccaggctatcagcaagcacctcccccaggtatgtca
agagctccaccttcttcaggggcccctccagcctcaacagcacaggcctcttgtggccag
ggtgcatatggccagtttggccaaggagatgtacagaatgggcctagctccactgttcaa
atgcaaaggctccctgggtctcagccatttgggtcagccccattggcccctgtggtcagc
cagccaactgtgcttcagccgtatggccctcccccaacaagtgcacaggtgactgctcag
ctggctggaatgcagatcagtggtgctgcgaccccagcccctcccccttcagggttgggc
tatggcccaccaacatcactggcctcagcctcaggaagtttccctaactctggtctgtat
ggttcctatcctcaaggccaggctcctccccttagccaggcccaaggtcattctggggcc
cagcctccccagcgatctgccccacagcaggcctccagcttcacaccccaagcttcaggg
ggtcctcggatgccttcgatgactggtccacccctgtctggacagagttttgggggaccc
ccagtgaaccagcccaaccatgtgtcctcacctcctcctcaaactctgcaccctggtacc
cagatggctgggcccccaggaccaccgccccctatgcactcctcccagcagccaggctat
cagctacaacaaaatggttcctttggaccaccccggggccctcagcccaattatggaagt
ccctacccaggagcacccacttttggcaatcaacctgggcctcctcagccactgcctcct
aagcgcctggatcctgatgccatccctagcccgattcaggttattgaggatgacaggaac
aaccggggttcagagccatttgttactggagtacggggccaggtgccacccttagttacc
accaacttcctagtgaaagaccaaggaaatgcaagtccccgatacattcgatgcacatcc
tataatataccttgcacatctgacatggctaagcaggctcaggtgcccctggcagctgtc
atcaagccgttggcaaggctgcccccagaagaggcttcaccgtatgttgtcgaccatggg
gaatctggccctttgcgctgcaatcgctgcaaagcatacatgtgccctttcatgcagttc
attgagggagggaggcgcttccagtgctgtttttgcagctgtatcaatgatgttcccccc
cagtattttcaacatctggatcataccggcaaacgtgtggatgcttatgaccgtcctgag
ctatccctgggctcttatgaattcttggccactgtagattactgcaagaacaataagttc
cccagccctcctgccttcatcttcatgattgatgtctcctacaatgccatcaggagtggt
cttgttaggctcctctgtgaggagctcaagtcactgttagactttctacctagggagagt
ggagcagaagagtcagcaatccgagttgggtttgtcacctataataaggtgctccacttc
tacaatgtgaagagctcattggcccagccacagatgatggttgtatctgatgtggctgac
atgtttgtgccactactggatggcttcctggtcaatgtcaatgagtctcgggcagtcatc
accagcttattggatcagattccagaaatgtttgcagacacaagagagacagagacagta
tttgccccagttatccaggctgggatggaggcactgaaggctgccgaatgtgcagggaag
ctgtttctattccacacctccctgcccattgcagaggccccagggaaactgaagaataga
gatgacaggaagttgatcaacacagacaaggagaagactctgttccagcctcagacaggt
gcttatcagaccctggccaaagagtgtgtggcccaaggttgctgtgtagacctcttcctc
ttccctaaccagtatgtggatgtggccacgctctctgttgtaccccagctcactggtggc
tctgtctacaaatatgcttgctttcaggtagagaatgaccaggagcggttcatgagtgat
ctgcgtcgggatgtacagaaggttgttggctttgatgctgtgatgcgagtccggacgagc
accggtattcgtgctgtagatttctttggggctttctacatgagcaatacaacagatgtg
gagctggctggactggatggagacaagacggtgaccgtggaattcaagcatgatgatcgg
cttaatgaagagagtggagccctcctgcagtgtgctctgctctataccagctgtgcaggg
cagcgacggctccgcatacacaacttggccctgaactgctgcacccagctagctgatctg
tatcgaaactgtgagactgacacactcatcaactacatggccaagtttgcataccgggga
gtcttgaacagccctgtgaagactgttcgtgacactcttatcacccagtgtgcccagatc
ctggcttgttacagaaagaactgtgccagtccctcctctgcaggacagttgatccttcct
gagtgcatgaagctactcccagtttacctgaactgtgtgttgaagagtgatgtcctgcag
cctggagctgaagtcactactgatgaccgtgcctatgtccgacagctggttacctccatg
gacgtggctgagaccaatgtcttcttctatcctcggctcctacctttgacaaagtctccc
attgagagtaccactgaaccaccagcaattagagcatcagaagagcgtctaagcaacggg
gatatatatttgttggagaatgggctcaaccttttcatctgggtgggagcaggtgtccaa
cagggtgttgtccagagtcttttcagtgtctcctccttcagtcagatcaccagtggcttg
agtattctgccagttctggataatccgctgtccaagaaggtgcgaggcctcattgatagc
ttaagggcacagagatcgcggtacatgaagcttatcgtggtgaaacaggaggacaagctg
gagatgctgttcaaacacttcctggtggaagacaagagcctgagtgggggagcatcctat
gtggactttctctgtcatatgcacaaggagattcggcagctactgagctag

DBGET integrated database retrieval system