KEGG   Miniopterus natalensis: 107525640
Entry
107525640         CDS       T05883                                 

Symbol
PIAS4
Name
(RefSeq) E3 SUMO-protein ligase PIAS4 isoform X1
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis
Pathway
mna04064  NF-kappa B signaling pathway
mna04120  Ubiquitin mediated proteolysis
mna04630  JAK-STAT signaling pathway
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107525640 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107525640 (PIAS4)
   04064 NF-kappa B signaling pathway
    107525640 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107525640 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107525640 (PIAS4)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107525640 (PIAS4)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   107525640 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse DARPP-32 SAP CENP-B_dimeris
Other DBs
NCBI-GeneID: 107525640
NCBI-ProteinID: XP_016053325
LinkDB
Position
Unknown
AA seq 503 aa
MVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKS
SEPVSQPHRPLDPLTMHSTYERASTVPRTPLTGPNIDYPVLYGKYLNGLGRLPAKTLKPE
VRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQ
VVLRICYSDTSSPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMY
LSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCKALVKEKLRLD
PDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDK
PAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQCPILVLGTSDAN
GLLSSPNVNGGGGSMLGGSGGGGSTVGSIENGKPGADVVDLTLDSSSSSEEEEEEEEDEE
EEDEDGPRPKRRCPFQKGLVSAC
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggtgatgagtttccgagtctccgatcttcagatgctcctgggttttgttggccggagt
aagagtggacttaagcacgaacttgtcacccgggccctccagctggtccagtttgactgt
agccctgagctgttcaagaagataaaggagctctacgagacacgctacgccaagaagagt
tcagagcctgtctcccaaccccaccggcccctggatcccctgaccatgcactcgacctat
gaacgggccagcactgtgcccaggactccactcacaggcccgaacattgactaccctgtg
ctctatgggaagtacttaaatggactcggacggttgcctgccaagaccctcaagccagaa
gtgcgcctggtgaagctgcccttctttaacatgctagatgaattgctgaagcccaccgaa
ctggttccacagaataacgagaagcttcaagagagcccgtgcatcttcgcattgacaccc
agacaggtggagctgatcaggaactccagagaactgcagcctggggtcaaggccgtgcag
gtcgtcctaagaatctgttactcagacaccagcagccctcaggaggaccagtacccaccc
aacattgctgtgaaagtcaaccacagctactgctcagttccgggctactacccctcaaat
aagcccggagtggagcccaaaaggccctgccgccccatcaacctcactcacctcatgtac
ctgtcctcggccaccaaccgcatcactgtcacctgggggaactatggcaagagttactcg
gtggccttatatttggtgcggcaactgacctcctcagagctgctgcagaggttgaaaacc
atcggggtcaagcatccggagctgtgcaaggcgctggtcaaagagaagctccgcctggac
cctgacagtgagattgccaccaccggcgtgcgggtctctctcatctgcccactggtgaag
atgcggctgtccgtgccctgccgggcagagacctgcgcccacctgcagtgcttcgatgct
gtcttttacctccagatgaatgagaagaagcctacctggatgtgcccggtgtgtgacaaa
ccagccccctacgaccagctcatcatagatgggctcctctccaagatcctgagtgagtgc
gaggatgccgatgagattgaatacctggtagatggctcatggtgcccgatccgtgccgag
aaggagcgcagctgcagcccccagtgccccatcctcgtgctcggcacctcagacgccaat
ggcctcctatccagccccaacgtcaacggtggtggtggcagcatgcttgggggctctgga
ggcgggggcagcacagtgggcagcattgaaaatgggaagccgggagctgatgtggtggac
ctcacgctggacagctcctcgtcctcagaggaagaggaggaggaggaggaagatgaggag
gaggaggatgaggacggcccccggcccaagcgccgctgccccttccagaagggcctggtg
tcagcctgctga

KEGG   Miniopterus natalensis: 107525838
Entry
107525838         CDS       T05883                                 

Symbol
PIAS1
Name
(RefSeq) E3 SUMO-protein ligase PIAS1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
mna  Miniopterus natalensis
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04630  JAK-STAT signaling pathway
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107525838 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107525838 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107525838 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107525838 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107525838 (PIAS1)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     107525838 (PIAS1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   107525838 (PIAS1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    107525838 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 107525838
NCBI-ProteinID: XP_016053556
LinkDB
Position
Unknown
AA seq 642 aa
MVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKI
MTPADLSIPSVHSGPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSAL
HPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISG
TKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRP
INITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAKGIRNPDHSR
ALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKK
PTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKKEVQEVSSSY
NGVDGCLSSTLEHQVTSHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRACPSLSPTSP
LNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFL
SGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSS
GSNSSLVSSNSLRESHSHTVTNRSSSDTASIFGIIPDIISLD
NT seq 1929 nt   +upstreamnt  +downstreamnt
atggttatgagccttagagtttctgaacttcaagtactattgggctacgctgggagaaac
aagcacggacgcaaacacgaacttctcacaaaagccctgcatttgctaaaggctggctgc
agtcctgctgtacaaatgaaaattaaagaactctataggcggagattcccccagaaaatc
atgacgcccgcggacttgtccatccccagtgtacattcaggtcctatgccagcaactttg
tctccatctaccattccacagctcacttatgacggtcaccctgcatcatcaccattactc
cctgtctctcttctgggacctaaacatgaactggaactcccacaccttacgtcagctctt
cacccagtccatccggatataaaacttcaaaaattaccattttatgatttactggatgaa
ctgataaaacccaccagtctagcatcagacaatagtcagcgttttcgagaaacctgtttt
gcatttgcattgacaccacaacaagtgcagcaaatcagtagctcaatggatatttctggg
accaaatgtgacttcacagtgcaggtccagttaaggttttgtttatcagaaaccagttgt
ccacaagaagatcatttcccacctaatctttgtgtgaaagtgaacacaaaaccttgcagc
cttccaggttatcttccacctactaaaaatggtgtggaaccaaagcgacccagccgacca
ataaatatcacctcacttgtccgattgtccacaacagtaccaaacaccattgttgtttct
tggactgcagaaattggaagaaactattccatggcagtatatcttgtaaaacagttgtcc
tcaacagtgcttcttcagaggttacgagcaaagggaataaggaatccggatcattctaga
gctttaattaaagagaaattgactgcggatccagacagtgaaatagctacaaccagccta
agggtttctctactatgtccacttggtaaaatgcggctgacaattccatgtcgggctctt
acctgttctcatctacagtgctttgatgcaactctttatattcagatgaatgagaaaaag
ccaacctgggtttgtcctgtctgtgataagaaggctccgtacgagcaccttattattgat
ggcttgtttatggaaatcctaaagtactgtacagattgtgatgaaatacagtttaaggag
gatggctcttgggcacctatgagatcaaaaaaggaagtacaagaagtttcttcctcttac
aatggagttgatggatgcttgagctccacactggagcatcaggtgacttctcaccaccag
tcctcaaataaaaataagaaagtagaggtgattgacctaaccatagacagttcttctgat
gaagaggaggaagagccatctgccaagagagcctgtccttccttatctccaacatcacca
ctaaataataaaggcatattaagtcttccacatcaagcatctccagtgtcccgcacccca
agcctccctgctgtagacacaagttatattaacacatccctcatccaagactacaggcat
cctttccacatgacacccatgccttatgacttacaaggattagatttctttcctttctta
tcaggagacaatcagcattataacacctccctcctcgccgctgcagcagcagcagtttcc
gatgatcaagacctcttacactcgtctcgattttttccgtatacttcctcacagatgttt
ctcgatcagttaagtgcaggaggcagtacttctctgccaaccaccaatggaagcagtagt
ggcagtaacagcagcctcgtgtcctccaacagcctaagggagagccatagccacactgtc
acaaacaggagcagctcggacacagcgtccatctttggcatcataccagacattatttca
ttggactga

KEGG   Miniopterus natalensis: 107529097
Entry
107529097         CDS       T05883                                 

Symbol
PIAS3
Name
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
mna  Miniopterus natalensis
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107529097 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107529097 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107529097 (PIAS3)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     107529097 (PIAS3)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   107529097 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 107529097
NCBI-ProteinID: XP_016057882
LinkDB
Position
Unknown
AA seq 635 aa
MVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKT
LGPSDLSLLSLPPGTPPVGSSGPLAPIPPALLAPGTLLGPKREVDMHPPLPQPVHPDVTM
KPLPFYEVHGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQ
VQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGVEPKRPSRPINITPLAR
LSATVPNTIVVNWSSEFGRVSMAESGRMEKPATQGNYSLSVYLVRQLTAGTLLQKLRAKG
IRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAAL
YLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPLKPKKE
ASEVCPPPGYGLDGLQYSPVQEGNPSENRKKVEVIDLTLESSSDEEDLPPTKKHCPVTSA
AIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFS
FLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHRSTTPAPPPGRV
SSIVAPGGALREGHGGPLPPGPSLTGCRSDIISLD
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggtgatgagtttccgggtgtctgagctccaggtgctccttggctttgctggccgcaac
aaaagtggacggaagcacgagctcctggccaaggccctgcacctcctcaagtccagctgt
gcccccagtgtccagatgaagatcaaagagctgtaccgccgacgcttcccccgaaagaca
ctggggccctctgatctctcccttctctctttgccccctgggactcctcccgtgggctcc
tctggtcctctagctcccatcccccctgccctcttggcccctggcaccctgctgggcccc
aagcgtgaagtggacatgcacccccctctgccccagcctgtgcaccctgatgtcaccatg
aaaccattgccattctacgaagttcacggggagctcatccggcccaccacccttgcatcc
acctctagccagcggtttgaggaagcgcactttacttttgcgctcacaccccagcaagtg
cagcagattctcacatccagagaggttctgccaggagccaaatgtgattataccatacag
gtgcagctaaggttctgtctctgtgagaccagctgcccccaggaggattatttccccccc
aacctgtttgtcaaggtcaatgggaaactgtgccctctgccgggttaccttccccctacc
aagaatggggttgagcccaagaggcccagccgccccatcaacatcacacccctggctcga
ctctcggccactgttcccaacaccatcgtggtcaactggtcatctgagtttggacgggtg
agcatggctgagtcaggaaggatggagaagcctgcaacacagggaaattactccttgtct
gtgtacctggtgaggcagttgactgcagggactcttctacaaaaactcagagcaaagggc
atccggaacccagatcactcccgggcactgatcaaggagaaattaacggctgacccggac
agtgaggtggccactacaagtctccgagtgtcactcatgtgcccgctagggaagatgcgc
ctgactgtcccttgtcgtgccctcacctgcgcccacctacagagcttcgacgctgccctg
tatctacagatgaatgagaagaagccaacgtggacatgtcctgtgtgtgacaagaaggct
ccctatgaatctcttatcattgatggtctattcatggagattcttaattcctgctcggat
tgtgatgagatccagttcatggaagatggatcctggtgcccattgaaacccaagaaggag
gcatctgaggtttgccccccgccagggtatgggctggatggcctccagtacagcccagtt
caagagggcaatccctcagagaataggaagaaggttgaagttattgacctgacattagaa
agctcatcagatgaggaggacctgcccccaacgaagaagcactgtcctgtcacctcagct
gccatcccggctctacctggaagcaaaggagtcttgacatctggtcaccagccctcttcg
gtgctccggagccctgctatgggaacgctgggtggagatttcctgtccagtctcccacta
catgagtacccacctgccttcccactgggggcagacatccaaggtttagatttattttct
ttccttcagactgaaagtcagcactatggtccctccgtcatcacctcgctagatgaacag
gatgcccttggccatttcttccagtaccgagggaccccttcccacttcctgggcccacta
gcccccacattggggagctctcaccgcagcaccactccagcaccccctcctggccgtgtc
agtagcattgtggctcctgggggggccttgagggaggggcatggaggacccctgccccca
ggtccctctttgactggctgccgttcagacatcatttccctggactga

KEGG   Miniopterus natalensis: 107546617
Entry
107546617         CDS       T05883                                 

Symbol
PIAS2
Name
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X1
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
mna  Miniopterus natalensis
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107546617 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107546617 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107546617 (PIAS2)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     107546617 (PIAS2)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   107546617 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 107546617
NCBI-ProteinID: XP_016080538
LinkDB
Position
Unknown
AA seq 613 aa
MVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTL
EGLSDLSTIKSSVFSLDGSSSPVEPDLAVAGIHTLPSTSVTPHSPSSPVGSVLLQDTKPT
FEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVR
EICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPK
NGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLK
MKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFD
AALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILSDCSDVDEIKFQEDGSWCPMRP
KKEAMKVSSQPCTKIESSSVLSKPCSVTIANEASKKKVDVIDLTIESSSDEEEDPPAKRK
CIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLP
GLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSETGVIT
SSGSNIPDIISLD
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggtttctagttttagggtttctgagctacaagtgttactaggctttgctggacggaat
aaaagtggacgcaagcatgacctcctgatgagggcgttgcatttattgaagagcggctgc
agccctgcggttcagattaaaattcgagaattgtatagacgccgatacccacggactctt
gaaggactttctgatttatccacaatcaaatcatcggttttcagtttggatggtagctct
tcacctgtagaacctgacctggctgtggctggaatccacacgttgccttccacttcagtt
acacctcactcaccgtcctcccctgttggttctgtgttgcttcaagacactaagcccacg
tttgagatgcagcagccatctcccccaattcctcctgtccatcctgatgtgcagttaaaa
aacttgcccttttatgatgttcttgatgttctcatcaagcccacaagtttagttcaaagc
agtattcaacgatttcaagagaagttttttatttttgctctgacccctcaacaagttaga
gagatatgcatatccagggattttttaccaggtggtaggagagattatacagtccaagtt
cagctgagactttgcttggcagagacaagttgccctcaagaagataactatcccaatagt
ctatgtataaaagtaaatgggaagctttttcctttgcctggctacgcaccaccacctaaa
aatgggattgaacagaagcgtcctggacgccctttgaatattacatctttagttaggttg
tcttcagctgtgccaaaccagatttccatttcttgggcatcagaaattggaaagaattac
tccatgtctgtatatcttgtacgacagctcacatcagccatgttattacagagattaaaa
atgaaaggtattagaaaccctgatcattccagagcactaattaaagaaaaacttactgca
gatcctgatagtgaaattgctacaactagccttcgagtatccttgatgtgccctttaggg
aagatgaggctgacaatcccatgccgagcagtgacttgtacacatctacagtgttttgat
gctgccctttatctgcaaatgaatgagaagaagcccacctggatttgtcccgtgtgtgat
aaaaaagctgcctatgaaagtctaattttagatgggctttttatggaaattctcagtgac
tgttctgatgtggatgagatcaaattccaagaagatggctcttggtgtccaatgagaccg
aagaaagaagctatgaaagtatccagccagccgtgtacaaaaatagaaagttcaagtgtc
ctcagtaagccttgttcagtgactatagccaatgaggcaagcaagaagaaagtggatgtt
attgacctaacaatagaaagctcttctgatgaagaggaagaccctcctgccaaaaggaag
tgcatctttatgtcagaaacacaaagcagcccaaccaaaggggttctcatgtatcagcca
tcttctgtaagggtgcccagtgtgacttcggttgatcctgctgctattccgccttcatta
acagactactcagtaccattccaccacacgccaatatcaagcatgtcatcagatttgcca
ggtttggattttctttcccttattccagttgatccccagcagtactgtcctcctatgttt
ttggatagtctcacctcacccttaacagcaagcagtacgtctgtcaccaccaccagcccc
catgagagcagtactcatgttagttcatccagcagcaggagtgagacaggggtcataacc
agcagtggaagtaacattcctgacatcatctcattggattaa

DBGET integrated database retrieval system