KEGG   Miniopterus natalensis (Natal long-fingered bat): 107525648
Entry
107525648         CDS       T05883                                 
Symbol
UBXN6
Name
(RefSeq) UBX domain-containing protein 6 isoform X1
  KO
K14011  UBX domain-containing protein 6
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107525648 (UBXN6)
SSDB
Motif
Pfam: PUB UBX
Other DBs
NCBI-GeneID: 107525648
NCBI-ProteinID: XP_016053338
LinkDB
Position
Unknown
AA seq 442 aa
MKKFFQEIKADIKFKSAGAGQKLTESVGEKAPKEKPNQLARQQPRQGPTNEAQMAAAAAL
ARLEQKQPRARGPTSQDFIRNQVRKELRAEATVSGITEAPGTNMVPEPKEEGSTPLAVPG
VYFTCPLTGAILRKDQRDTRIKEAILSHFSTDPVAASIMKIHTFNKDRDRVKLGVDTIAK
YLDNIHLHPEEEKYRKIKLQNKVFQERINCLEGTHEFFEAIGFQKALLPVPDQEGPEEFY
VLSEAVLAQPESLERHKEQLLCAEPVRATLLRQRRVFQPSPLASQFDLPSDFFNLTAEEA
KREQKLRSEAVERLSMLRTKAMREKEEQREMRKYTYTLLRVRLPDGCLLQGTFYARERVA
ALYSFVREALQNDWLPFELLASCGQKLSEDENLAFNECGLVPSALLTFSWDMAVLEDIKA
AGARPDSSILKPELLVTIEKLS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaagaaattcttccaggagatcaaggctgacatcaagtttaagagtgcgggtgccgga
cagaagctcacggagtcggtgggggagaaggcccccaaagaaaagcccaaccagctggcg
cgccagcagccccgccagggacccaccaatgaggcacagatggcagctgcagcagccctg
gcccggcttgagcagaagcagcccagggcccggggccccacatcacaggacttcatccgg
aatcaggtgagaaaggaacttcgagctgaagcaactgtcagtgggatcacagaggcacca
gggactaacatggtacccgagcctaaagaggaaggctcgactcccctggcagtgcctgga
gtgtacttcacctgcccgctcacaggggccatcctgaggaaggaccagcgtgacacccga
atcaaagaggccattctctcacacttctccactgacccagtagctgcttccatcatgaag
atccatacgttcaacaaagatcgggacagggtgaagctgggcgtggataccattgccaag
tacctggacaatatccacctgcaccctgaggaggagaagtaccggaagatcaagctgcag
aacaaggtgttccaggaacgcattaactgcctggaagggacccacgagttttttgaggcc
attggtttccagaaggcattgttgccagttccagatcaggagggccccgaagagttctac
gttctaagcgaggccgtcttggcccagcccgagagcctggagaggcataaggagcagctg
ctgtgcgctgaacctgtgcgggccacactgctccgccagcgccgtgtcttccagccctcg
ccgctggcctctcagtttgacctgccctctgacttcttcaacctcacggccgaggaggcc
aaacgggagcagaaactcaggtctgaggcggtggagaggctgagcatgctgaggaccaag
gctatgcgggagaaggaggagcagagggagatgcgcaagtacacttacacactgctgcgt
gtccgtcttcccgacggctgcctcctccaggggaccttctatgcgcgggagcgggtggca
gcactgtatagctttgtccgggaagccttgcagaatgactggctccccttcgagctgctg
gcctcgtgtgggcagaagttgtcagaggatgagaacttggctttcaatgagtgtgggctg
gtgccctcagccctcctgaccttctcgtgggacatggcggtactagaggacatcaaggcc
gcaggggccaggccagactcatctatcctgaaacccgagctcctggtaaccatcgagaag
ctctcgtga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107532005
Entry
107532005         CDS       T05883                                 
Symbol
UBXN4
Name
(RefSeq) UBX domain-containing protein 4
  KO
K24348  UBX domain-containing protein 1/4
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107532005 (UBXN4)
SSDB
Motif
Pfam: Thioredoxin_7
Other DBs
NCBI-GeneID: 107532005
NCBI-ProteinID: XP_016061744
LinkDB
Position
Unknown
AA seq 351 aa
MLWFQGAIPAAIASAKSSGAVFVVFVAGDDEQSTQMAASWEDEKVTEASSNNFVAIKIDT
KSEACLQFSQIYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVRQMHSLKGETS
VVNGSQSENSVSTPSTSFEPNNTSENSQPRNVELCETTPTSDTKSDSATGGEGSDHATSS
QEPSGCSDQRPAEDLTVRVERLTKKLEERREEKRKEEEQREIKKEIERRKTGKEMLDYKR
KQEEELTKRMLEERNREKAEDKAARERIKQQIALDRAERAARFARTKEEVEAAKAAALLA
KQAEMEVKKEASARQRRYFIFYLNVFVYVAAEKNRGCKLLFNTDVCCGYNK
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgctgtggttccagggcgccattcccgccgccatcgcgtcggccaagagcagcggcgcg
gtcttcgtggtattcgtggcaggtgatgatgagcagtctacacagatggctgcaagttgg
gaagatgagaaagttacagaagcatcttcaaacaattttgttgctattaaaatcgatacc
aaaagtgaagcctgcctacaattttcacaaatctatcctgtagtgtgtgttccatccagt
ttctttattggagacagtggaattcccttggaagtaatagcaggaagtgtttccgcagat
gaacttgttaccagaattcacaaagtccggcagatgcactcattaaaaggtgaaacatca
gtggtaaatggcagccagtcagaaaattcagtctctactccatccacctcatttgaacct
aacaacacttctgaaaactctcagcccagaaatgtagagctttgtgagacaacacccact
tctgatacaaaatcagattctgcaacaggaggagaggggtcagatcatgccacttcgtct
caggagcctagtggatgttcagatcagagacctgcggaggacctcactgtcagagtggaa
agactaacgaaaaaacttgaagaaaggagagaagagaagaggaaagaggaagaacagaga
gagattaagaaagaaattgagaggagaaaaactggaaaagaaatgttggattataaaaga
aagcaagaagaggaattaacgaaaagaatgttagaggaaagaaacagagaaaaggcagaa
gataaggcagcgcgagagcgtattaaacagcagattgcactggatcgtgcagagagagct
gctcgttttgcaaggacaaaggaagaagtagaagctgctaaagctgctgccttgttggct
aaacaggcagaaatggaagttaagaaggaggcttctgcaagacaaaggaggtactttatt
ttctacttaaatgtctttgtttatgtagcagctgagaagaaccgtggttgtaagctgctt
tttaacactgatgtgtgctgtggctataataagtag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107533965
Entry
107533965         CDS       T05883                                 
Symbol
UBXN2A
Name
(RefSeq) UBX domain-containing protein 2A
  KO
K24349  UBX domain-containing protein 2A
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107533965 (UBXN2A)
SSDB
Motif
Pfam: SEP UBX Spt20
Other DBs
NCBI-GeneID: 107533965
NCBI-ProteinID: XP_016064384
LinkDB
Position
Unknown
AA seq 258 aa
MKEVDNLESIKEEWVCETGSDNQPLSDNRQTTCEYFVNSLFEEAQKFGAKCLSPTEQKKQ
VDVSIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPLELQGAVGKEEVDVEVEDKKH
EVCAATKPVFQPFSGAGHRLGSATPKIISKARSIEVEKKNNVSTVPLNTLEPITNIQIWL
ASGKRVVQKFNTSHRISHIKDFIEKYQGCQRSAPFSLATARPRLRALDEALTLEEADLQN
AVVIQRLQKAAGPPGELS
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaaagaagtagataatcttgaaagtataaaagaagaatgggtttgtgaaacaggatcc
gacaaccagcctcttagtgataatcgacagacaacttgtgaatattttgtcaacagcctt
tttgaggaagcccagaagtttggcgccaaatgcttgtctcccaccgaacagaagaaacag
gtagacgtgagtataaaattatggaaaaatggattcacagtcaatgacgacttcagaagt
tattcagatggtgcaagtcagcagtttctaaattccatcaaaaagggggagctgcctttg
gagctgcagggcgccgtgggcaaggaggaggtggatgtggaagtggaagacaagaaacac
gaagtgtgtgcggccacgaagcccgtgttccagcccttctcgggcgcgggccaccggctg
gggagtgccacaccaaaaattatttctaaagcaagaagtatcgaagttgagaagaaaaat
aatgtttctactgtcccactaaacaccctggagcccatcactaacatacagatctggtta
gccagcgggaaaagggttgttcagaaatttaacacgtctcataggataagccacatcaaa
gacttcatcgagaagtaccaagggtgtcagaggagcgctcccttttcgctggcgaccgct
cggcctcgcctcagggccctggacgaggcgctcactctggaggaagcggacctgcagaac
gccgtcgtcatccagaggctccagaaggccgccgggcctcctggagaactgtcatag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107534102
Entry
107534102         CDS       T05883                                 
Symbol
UBXN8
Name
(RefSeq) UBX domain-containing protein 8
  KO
K24351  UBX domain-containing protein 8
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107534102 (UBXN8)
SSDB
Motif
Pfam: UBX EMC3_TMCO1
Other DBs
NCBI-GeneID: 107534102
NCBI-ProteinID: XP_016064565
LinkDB
Position
Unknown
AA seq 275 aa
MAARGVVGIFLLSALPLLCLELRRGIPDLGIKDIILLCGRIFLLLAVLTLIISVTTSWLN
SFKSSQVYLKEEEEKNEQRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLKKLEERFYR
MTGETWKLSNGHKLGGGEDAVLENDSQVSFDTSNRKAAKRRNLPKLSAKVSPPAEQPTQK
EVSDLPEEPSETAEEVVTIALRCPSGSVLRRRFLKSCNSQVLFDWMVKIGYHTSLYGLST
SFPRVPLEVEGGWSLRDIGITVDTVLNVEEREPSN
NT seq 828 nt   +upstreamnt  +downstreamnt
atggccgcccgtggggtcgtgggcatcttcctcctctccgcgctccctctcttgtgtctg
gagctgcggcgtgggatcccggacctaggaattaaagatataattttgctgtgtggccgg
attttcttactgcttgctgttcttactttgattatttctgtgacaacctcatggcttaac
tcatttaaatcttctcaagtttatctgaaagaagaagaagagaagaatgagcaaaggcaa
aaacttgtgagaaaaaaacaacaagaggcacaaggtgaaaaggccagcagatacatagag
aatgttctaaaacctcaccaggaaatgaaattgaaaaaactggaagagcgcttttatcga
atgacgggtgaaacctggaagttaagcaatggtcataaacttgggggtggtgaagatgcg
gtgcttgaaaatgacagtcaggtatcttttgacacatcaaacagaaaagcagcaaagaga
cggaacttgcctaagctgtcagccaaagtttcaccacctgctgaacagcccacgcagaag
gaggtttcagatttacctgaagaaccttctgaaacagctgaagaagtggttactattgct
ctccggtgtccaagtgggagcgtcctgaggagaaggtttcttaagtcttgcaattcacag
gttttatttgattggatggtgaaaattgggtaccacacatccctatacggcctttctact
tcctttcccagagtgcctctggaagtggagggaggctggtcactgcgggacataggaata
actgtggatactgtactcaatgtagaagaaagagagccaagcaactag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107543110
Entry
107543110         CDS       T05883                                 
Symbol
UBXN1
Name
(RefSeq) UBX domain-containing protein 1
  KO
K24348  UBX domain-containing protein 1/4
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107543110 (UBXN1)
SSDB
Motif
Pfam: UBX UBA Selenoprotein_S
Other DBs
NCBI-GeneID: 107543110
NCBI-ProteinID: XP_016076024
LinkDB
Position
Unknown
AA seq 296 aa
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLATPLGHVL
GREPTSSEQGGPEGPESAVEEDKPVLSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVSSQPSPPTEPGPVPSSPSQEPPSKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRL
YVELHRGEEPGGDQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcggagctgacggctctggagagtctcatcgagatgggcttccccaggggacgcgcg
gagaaggctctggccctcacagggaaccagggcatcgaggccgcgatggactggttgatg
gagcacgaagacgaccccgatgtggacgagccgctagcgaccccccttggacatgtcctg
ggacgggaacccacctcctcggagcagggtggccccgaaggtcctgagtccgctgtggaa
gaagacaaacccgttttgagtgaagaggaaagacaggaacagacaaagaggatgttggag
ctggtggcccagaaacagcgggaacgtgaagaaagagaagaacgggaggcattggaacgg
gaacggcagcgcaggagacaagggcaggagctctcagctgctagacagcggctacaggaa
gatgagatgcgcagggccgctgaggagcgcaggagagaaaaggctgaagagttagcggcc
aggcaaagagtccgagaaaagattgaaagagacaaagcagagagagccaagaagtatggt
ggtagtgtgagttctcagccatccccaccaacagaaccaggtcctgttccctcctctccc
agccaggagcctcctagcaagcgggagtatgaccagtgtcgcatacaggtccggctgcca
gatgggacctcactcacccagacgttccgggcaagggaacagctggcagctgttaggctc
tatgtggagcttcaccgtggggaggaacctggaggggaccaagaccctgtgcagttgctc
agtggcttcccccggcgagccttctcagaggctgacatggagcggcctctgcaggagctg
ggacttgtgccttctgctgtcctcattgtggccaagaaatgtcccagctga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107544437
Entry
107544437         CDS       T05883                                 
Symbol
NSFL1C
Name
(RefSeq) NSFL1 cofactor p47 isoform X1
  KO
K14012  UBX domain-containing protein 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107544437 (NSFL1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544437 (NSFL1C)
Membrane trafficking [BR:mna04131]
 SNARE
  SNARE associated proteins
   Others
    107544437 (NSFL1C)
SSDB
Motif
Pfam: SEP UBX Spt20 NUP50
Other DBs
NCBI-GeneID: 107544437
NCBI-ProteinID: XP_016077815
LinkDB
Position
Unknown
AA seq 306 aa
MSDNRVTSFKDLIHDQDEEEEEEEGQRSRFYAGGSERSGQQIVGPPRKKSPNELVDDLFK
GAKEHGAVAVERVTKSPGETSKQRPFAGGGYRLGAAPEEESAYVAGERRRHSGQDVHIVL
KLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFV
KPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSISIDESQPTTNIQIRLAD
GGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAV
IVQRLT
NT seq 921 nt   +upstreamnt  +downstreamnt
atgagcgataacagggtaacatccttcaaagacctcattcatgaccaagacgaagaggag
gaggaggaggagggccagaggagcaggttttatgctggaggctcagagagaagtggacaa
cagattgttggccctcccaggaagaaaagtcccaacgagctggtggatgatctatttaaa
ggtgccaaggaacatggagctgtagctgtggagcgagtgaccaagagccctggagagacc
agtaaacaaagaccatttgctgggggtggctaccgccttggggcagcaccagaagaagag
tctgcctatgtggcaggagaaaggaggcggcattccggtcaagatgttcatatagtgttg
aagctctggaagagtggattcagcctggacaatggtgaactcagaagctaccaagaccca
tctaatgcccagtttctggagtccatccgtagaggggaggtgccagcagagctacggagg
ttagctcatggtgggcaggtgaatttggacatggaggaccatcgagatgaggactttgtg
aagcccaaaggagccttcaaagccttcactggcgagggtcagaaactgggcagcactgca
cctcaggtattgagtaccagctctccagcccagcaagcagaaaacgaagccaaagccagc
tcttccatctcaatcgacgagtcacagcctaccacaaacatccaaatacggcttgccgac
ggtgggagactggtgcagaaatttaatcacagccacaggatcagtgacatccgactcttc
atcgtggatgcccggccagccatggctgccaccagctttgtcctcatgaccaccttcccg
aacaaagagctggctgatgagaaccagacccttaaggaagccaacctgctcaacgccgtc
attgtgcagcggttaacataa

DBGET integrated database retrieval system