KEGG   Miniopterus natalensis: 107525753
Entry
107525753         CDS       T05883                                 

Gene name
C3
Definition
(RefSeq) complement C3
  KO
K03990  complement component 3
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04145  Phagosome
mna04610  Complement and coagulation cascades
mna04613  Neutrophil extracellular trap formation
mna05133  Pertussis
mna05134  Legionellosis
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05150  Staphylococcus aureus infection
mna05152  Tuberculosis
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05203  Viral carcinogenesis
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107525753 (C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107525753 (C3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107525753 (C3)
   04613 Neutrophil extracellular trap formation
    107525753 (C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107525753 (C3)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107525753 (C3)
   05168 Herpes simplex virus 1 infection
    107525753 (C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107525753 (C3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107525753 (C3)
   05134 Legionellosis
    107525753 (C3)
   05150 Staphylococcus aureus infection
    107525753 (C3)
   05152 Tuberculosis
    107525753 (C3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107525753 (C3)
   05142 Chagas disease
    107525753 (C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107525753 (C3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107525753 (C3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107525753 (C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107525753 (C3)
Peptidases and inhibitors [BR:mna01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   107525753 (C3)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Phagocytosis
   Opsonins
    107525753 (C3)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107525753 (C3)
SSDB
Motif
Pfam: TED_complement A2M A2M_BRD MG1 MG4 A2M_recep NTR MG2 MG3 ANATO
Other DBs
NCBI-GeneID: 107525753
NCBI-ProteinID: XP_016053478
LinkDB
Position
Unknown
AA seq 1663 aa
MGPASGPSLLLLLLTSLPLALGDSMFSIITPNILRLENEETVVLEAHDSASDVPVKVMVY
DFPGKKQVLSSKETVLNKANSYLSTVTIKIPASKELKSQKGNKFVTIQAEFDKTVVEKVV
LISLQSGYLFIQTDKTIYTPGSTVLYRIFTVDHNLLPVGRTVIVSIETPEGIPVKRDTLS
SQNHFGILPLSWNIPELVNMGQWKIRAHYEDSPEQVFSTEFEVKEYVLPSFEVQVEPAEK
FYYIDDPKGLEVTITARFLYGKNVEGTAFVIFGVQDGDQRISLAQSLTRAVIDDGTGVAV
LSREVLLNGVQPSGEDALVGKSLYVSVTVILHSGSDMVEVERSGIPIVTSPYQIHFTKTP
KFFKPAMPFDLMVFVTNPDGSPARHIPVATQDSTQGQSLTQDNGVAKLTINTHRSSQPLS
ITVRTVKEGIPEARQATNKMQALPYSTMGNSNNYLHLSVPRVELKPGDTLHVNFHLRMDP
GQDANIRYYTYLVMNKGKLLKVGRQVREAGQDLVVLPLTITPDFIPSFRLVAYYTLITRG
QREVVADSVWVDVKDSCVGKLVVKSALKEEKQQHLPGQQISLKIEGNQGARVGLVAVDKG
VFVLNKKNKLTQSKIWDTVEKADIGCTPGSGKDYAGVFTDAGLAFQTNKGLKTEQRSDMS
CPKPATRRRRSVQLMEKRKDKAGQYPDKELRKCCEDGMRENLMKYSCQRRAQYILQGKAC
VSAFLDCCNYITQMRIQHLKKGNLGLARSDLDEDIIPEEDIVSRSQFPESWLWTIEDLKD
PEKNGVSSKTMKVFLKDSITTWEIMAVSLSDKKGICVADPYEVTVMQDFFIDLRLPYSVV
RNEQVEIRAVLYNYREANTLKVRVEMLYNPAFCSVATAKKRHQQVLSIPPKSSVAVPYVI
VPLKIGLQEVEVKATVYEFFISDGVRKTLKVVPEGIRMNKTVTVRTLDPQKLGQNGVQRE
EIEAADLSDQVPDTESETRILLQGTPVAQMAEDAIDGQRLQHLIVTPSGCGEQNMIGVTP
TVIAVHYLDYTEQWDKFGFNRRQEALDLIKKGYTQQLAFRQNNKAFAAFLHLPSSTWLTA
YVVKVFSLAANLIAIDSEVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRHAEEKD
VALTAFVLIALQEAKDICEGQVNSLQGSINKAGDFLESHYENLKRPYTVAIAGYALAQLG
KLEGPLLHKFLSTATEKNRWEEPGQKLYNVEATSYALLALLLLKDFDSVPPVVRWLNEQR
YYGGGYGSTQATFMVFQALAQYQRDVPDHNELNLDVSIDLPSRSSTVTHRILWESASLLR
SEATKENENFSLTAKGKGQGTLSVVTMYHAKIKDSAPCKKFSLRVNIRPAPEVKKPQDAK
DTMFLDICTKYLGDQDATMSILDISMMTGFAPDIGDLKQLTTGTDRYISKFELDNKAFSN
KNTLIIYLNKISHQLEDCLSFKVHQFFNVGLIQPGAVKVYSYYNLDETCTRFYHPEKEDG
MLSKLCHNEMCRCAEENCFMQHMEDKVTPEDRLDKACEPGVDYVYKTKLHRKELSDDFDE
YIMVIEQVIKSGTDEVLPGGERTFISHIKCRDALKLQEEKYYLIWGLSSDLWGEKSNIKY
IIGKDTWVELWPEADECQDEENQAVCRDLASFTENMVVFGCPN
NT seq 4992 nt   +upstreamnt  +downstreamnt
atggggcctgcttcaggtcccagcctgctgctgctactgctgaccagtctccccttggcc
ctgggggacagcatgttctccatcatcacccccaacatcctgcggctggagaacgaggag
acagtggtgctggaggcccacgatagcgcaagtgacgtccctgtcaaggttatggtatac
gacttcccgggcaagaagcaggtgctgtccagcaaggaaaccgtgctgaacaaagccaac
agctacctgagcaccgtcaccatcaagatcccggccagcaaggagctaaaatcacagaag
gggaacaagtttgtgactatccaggcagaatttgataaaactgtggtggagaaggtggtg
ctaatcagccttcagagcgggtatctcttcattcagacggacaagaccatctacacccca
ggctccacagtcctctatcggatcttcactgtcgaccacaatctgctgcccgtgggccgg
acggttatcgtcagcattgagacccccgaaggcattcccgtcaagagggacaccctgtct
tctcaaaaccactttggcatcttgcccttgtcttggaatatcccggagctggtcaacatg
gggcagtggaagatacgagcccactatgaagattccccagagcaggtcttctccactgag
tttgaggtgaaagaatatgtgctgcccagtttcgaagtccaagtggaacctgcagagaaa
ttctactacattgatgacccaaagggcctggaggtcaccattacagccaggttcctatac
gggaagaatgtggaaggaacagcgttcgtcatcttcggggtccaggatggtgaccagagg
atttcacttgcccagtcgctcacccgtgctgtgatcgatgatggcactggggtggctgtg
ctgagccgagaggtcctgctgaatggggtgcagccctctggagaggatgcccttgtggga
aagtcattgtacgtgtcggtcaccgtcatcctgcactcaggcagcgacatggtggaggtg
gagcgcagcgggatccccatcgtgacttccccctaccagatccacttcaccaagacgccc
aagttcttcaaacccgccatgccctttgacctcatggtgtttgtgacgaaccccgacggc
tccccagcccgccacatccccgtggcgactcaggactccacccaagggcagtctctgacc
caagataatggcgtggctaagctgaccatcaacacccacaggagctcccagcccctgtcc
atcactgtacgcacagtgaaggagggcatcccagaggcacgacaggccaccaacaaaatg
caggccctgccctacagcacgatgggcaactccaacaactacctgcacctctctgtgccc
cgagtggagctcaagccaggcgacacgctccacgtcaactttcacctgcgaatggaccct
ggccaggatgccaatatccgatactacacctacctggtcatgaacaaggggaagctcttg
aaggtgggacgccaggtgcgagaggccggccaggacctggtggtgctgcctctgaccatc
acgccagactttatcccttccttccgcctggtggcctattacacgctgatcaccagaggc
cagagggaggtggtggccgattccgtgtgggtggatgtcaaggactcgtgtgtgggcaag
ctggtggtgaaaagtgccctgaaggaggagaagcagcagcatctacctggacaacagata
tcgctcaagatcgagggcaaccagggggctcgagtggggctcgtggccgtggacaagggc
gtgtttgtgctgaataagaagaacaagttgactcagagtaagatctgggacacagtggag
aaggcagacattggctgcacaccgggcagtggaaaggactatgcgggcgtctttacggac
gcagggctggccttccagaccaacaaaggcctgaagacagaacagaggtcagatatgtcg
tgcccgaaaccagccacccggcgccgccgctcggtgcagctcatggagaagaggaaggac
aaagcgggacagtacccggacaaggagctgcgtaagtgctgcgaggacggcatgcgggag
aacctcatgaagtactcgtgccagcgcagggcgcagtacattctccagggcaaggcctgc
gtaagcgccttcctcgactgctgcaactacatcacccagatgcggatccagcacctcaag
aaggggaacctggggctggccaggagtgacctggatgaggatatcattccagaagaagac
atcgtttcccgaagccagttccctgagagctggctgtggaccatcgaggacttaaaggac
ccagagaaaaatggagtctcctcgaagaccatgaaggtgtttttgaaagactccatcacc
acctgggagattatggctgtgagcttgtcagacaagaaagggatctgcgtggctgacccc
tatgaggtgacagtgatgcaagatttcttcatcgacctgcggctgccctactccgtggtg
cgtaacgagcaggtggagatccgagccgttctctacaactaccgagaagcaaatacgctc
aaggtgagggtagaaatgctctacaacccagccttctgcagcgtggccactgccaagaag
cgtcaccagcaggttctgtcaatccctcccaagtcctcggtggccgtgccttatgtcatt
gtgcccctgaagatcggcctgcaggaggtagaggtcaaggccaccgtctatgagttcttc
atcagcgatggtgtaaggaagaccctgaaggtcgtgccagaaggaatcagaatgaacaaa
actgtgaccgttcgcacgctggatccacaaaagctgggccagaacggtgtgcagcgtgag
gaaatcgaggctgcagacctcagcgaccaagtcccagacacagagtcggaaaccaggatc
ctcctgcaggggaccccggtggcccagatggcagaggatgccatcgatgggcagcggcta
cagcacctcattgtgaccccctcgggctgcggagagcagaacatgatcggagtgacgccc
actgtcatcgcggtgcactacctggactacactgaacagtgggacaagtttggctttaac
aggcggcaggaggccctggacctcatcaagaaggggtacacgcagcagctggccttcaga
cagaacaacaaggcctttgcggccttccttcacctgccatccagcacctggctgacagcc
tatgtggtcaaggtcttctctctggctgccaacctcatcgccattgactccgaagtcctc
tgtggggctgtcaagtggctgatcctggagaagcagaagcctgatggagtcttccaggag
gatgggcccgtgatacaccaagaaatgattggtggcttcaggcatgctgaggagaaagat
gtagccctcactgccttcgttctcatcgcactgcaggaggctaaagatatttgcgaggga
caggtcaacagccttcagggcagcatcaataaggccggagacttccttgaatcccactac
gagaacttgaagagaccatatactgtggccattgctggctatgccctggcccagttgggc
aagctggagggtcccctcctccacaaatttctgagcacagccacagaaaagaaccgctgg
gaggagcctggccagaagctctacaatgtggaggccacgtcctatgccctgttggctctg
ctgctgctcaaagactttgactctgtgcctcctgttgtgcgctggctcaacgagcagaga
tactacggaggtggctatggctccacccaggccactttcatggtgttccaagccttggcc
caataccagagggacgttcctgaccacaatgaactgaatctggatgtgtccattgacctg
cccagccgcagctctacagtcacacaccgcatcctctgggaatccgctagcctcctgcga
tcagaagcgaccaaggaaaatgagaatttctcattaacagctaaagggaaaggacaaggc
accttgtcggtggtgacaatgtaccatgccaagatcaaagacagtgccccctgcaaaaag
ttcagcctcagggttaacatacgaccagcccctgaagtcaaaaagcctcaggacgccaag
gataccatgttcctcgacatctgtaccaagtacctaggagaccaggatgccactatgtcc
atcctggatatatccatgatgactggctttgctcctgacattggcgacctcaagcagctg
accactggcactgacagatacatctctaagttcgagttggacaacaaggccttctccaac
aagaacaccctcatcatctacctgaacaagatctcacaccaactggaggactgtctatcc
ttcaaagttcaccagttctttaatgtggggctgatccagccgggggcagtcaaggtgtac
tcctattacaacctggatgagacttgtacccggttctaccacccggagaaggaagacgga
atgctgagcaaactctgccacaatgaaatgtgccgctgtgctgaggagaactgcttcatg
cagcatatggaggacaaggtcactccggaagaccggctggacaaggcctgcgagccggga
gtggactatgtgtacaagaccaagctgcacaggaaggagctgtcggatgattttgacgag
tacatcatggtcatcgagcaggtcatcaaatcaggcaccgatgaggtgttgcctggaggg
gagcgcacgttcatcagtcacatcaagtgcagagacgccctgaagttgcaggaggagaaa
tactacctcatatggggcctgtcctcggacctgtggggagaaaaatccaacatcaagtac
atcattgggaaggacacctgggtggagctgtggcccgaagcggacgaatgccaggacgag
gagaaccaggcagtgtgccgggacctggccagcttcacagagaacatggtcgtgtttggc
tgtcccaactga

DBGET integrated database retrieval system