KEGG   Miniopterus natalensis (Natal long-fingered bat): 107525871
Entry
107525871         CDS       T05883                                 
Symbol
ERO1A
Name
(RefSeq) ERO1-like protein alpha
  KO
K10950  ERO1-like protein alpha [EC:1.8.4.-]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107525871 (ERO1A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107525871 (ERO1A)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-
     107525871 (ERO1A)
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 107525871
NCBI-ProteinID: XP_016053604
LinkDB
Position
Unknown
AA seq 451 aa
MRMQLSFRKDGEKWGKPSGVQVSGYLDDCTCDVETIDKFNNYRLFPRLQKLLASDYFRYY
KVNLKKPCPFWDDIGQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERL
GAVDESLSEETQKAVLQWTKHDDSSDNFCEVDDIQSPDAEYVDLLLNPERYTGYKGPDAW
RIWNVIYEENCFKPQTIKRPLNPLASSPGKSEENTFYSWLEGLCVEKRAFYRLISGLHAS
INVHLSARYLLQDTWLEQIWGHNVTEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSK
VVPFFERPDFQLFTGNKVQDADNKMLLLEILHEIKSFPLHFDENSFFAGNKKEADKLKEE
FRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKLIANMPESGPSYEFHLTR
QEIVSLFNAFGRISTSVKELENFRNLLQNVH
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgcgaatgcagctgagcttcaggaaagatggggagaagtggggaaaaccgtctggagtc
caggttagtggttacttggatgattgtacctgtgatgttgaaaccattgataaatttaat
aactacagactttttccaagactacaaaaacttcttgcaagcgactactttagatattac
aaggtaaatctgaagaaaccatgtcctttttgggatgacatcggccagtgtggaaggaga
gactgtgccgtcaagccttgtcaatctgatgaagttcctgatggaattaaatctgcaagc
tataagtattctgaagaagccaacaatctcattgaagaatgtgaacaagctgagcgactt
ggagctgtggatgaatctctgagtgaggaaacgcagaaggccgttcttcagtggaccaag
catgatgattcctcagacaacttctgtgaagttgatgacatacagtctcctgatgctgaa
tatgtggatttgctccttaatcctgagcgctacacgggttacaagggaccagatgcttgg
aggatatggaatgtcatctatgaagaaaactgctttaagccacagacaattaaaagacct
ttaaatcctttggcttccagtccagggaaaagtgaagagaacactttttacagctggcta
gaaggcctctgtgtagaaaaaagagccttctacagacttatatctggcctacacgcaagc
atcaatgtgcacctgagcgcacggtatcttctacaagatacctggttagaacagatatgg
ggacacaacgtcacagaatttcagcagcggtttgatggaattttgactgagggagaaggt
ccaagaaggcttaagaacttgtattttctctacttaatagaattaagggctttatctaaa
gtggtaccattctttgagcgcccagattttcaactcttcactgggaataaagttcaggat
gcagataacaaaatgttacttctggaaatacttcatgaaatcaagtcatttcctttgcat
tttgatgagaattcattttttgctgggaataaaaaggaagcagacaaactaaaggaggaa
tttcgacttcattttagaaacatttcaagaatcatggactgtgttggttgttttaaatgt
agactgtggggaaagcttcagactcagggtttgggtactgctctgaagatcttgttttct
gagaaactgatagcgaatatgccagaaagtgggcccagttacgaattccatctaaccaga
caagaaatagtatcattatttaatgcattcggaagaatttctacaagtgtgaaagaatta
gaaaacttcaggaacttgttacaaaatgttcattaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107527204
Entry
107527204         CDS       T05883                                 
Symbol
ERO1B
Name
(RefSeq) ERO1-like protein beta
  KO
K10976  ERO1-like protein beta [EC:1.8.4.-]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107527204 (ERO1B)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-
     107527204 (ERO1B)
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 107527204
NCBI-ProteinID: XP_016055368
LinkDB
Position
Unknown
AA seq 473 aa
MPPGAASPAAGFRGRDSDHGGRDAVGAEYTLEGAVSRALEVIGVLDDCLCDIDSIDNFNT
FKIFPKIKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKVPVGIKAGRS
NKYLKVANNTKEFEDCEQASKLGAINSTLSNQSKEAFIDWARYDDSQDHFCELDDERSPA
AQYVDLLLNPERYTGYKGPSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYT
WLEGLCLEKRVFYKLISGLHASINLHLCSNYLLEETWGKPSWGPNIKEFKRRFDPVETKG
EGPRRLKNLYFLYLIELRALLKVAPYFERSIVDLYTGNVEDDADTKTLLLDIFQDTKSFP
MHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKIL
FSEKEIQKLPENSPSKGFQLTRQEIVALVNAFGRLSTSIRELQNFKVLLQHSR
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgccgcccggtgctgcttcccctgcagctggttttaggggccgggacagtgaccacgga
ggccgggacgcggtgggtgcagaatacacgctagaaggtgctgtttcgagggctctagag
gtcatcggagtcctggatgattgtttgtgtgatattgatagcatcgataactttaacacc
ttcaagatcttccccaaaattaagaaactgcaagagcgagactacttccgttattacaag
gttaatctgaagcgaccgtgtcctttctgggcagaagatggccattgttccataaaagac
tgccatgtggagccttgtccagagagtaaagttccagtcggaattaaagctgggagatcg
aataagtacttgaaagtggcaaacaataccaaagaatttgaagattgtgagcaagctagt
aaactgggagcaattaacagcacattaagtaatcaaagcaaagaggctttcatcgactgg
gcgagatacgatgactcacaggatcacttctgtgagcttgatgatgagaggtctccagct
gcccagtatgtggacctgctgctgaacccagagcgttacactggctacaaagggccgtct
gcgtggagagtgtggaacagcatctacgaagaaaactgtttcaagcctcgatctgtttat
cgtcctctaaatcctctggcgcccagccgaggagaagatgatggagaatcattctacacg
tggctagaagggttatgtctggagaaaagagtcttctacaagcttatatcgggacttcat
gccagtatcaacttacatctgtgctcaaattatcttttggaagaaacctggggcaaacct
agctggggacctaatataaaagaatttaaacgccgcttcgaccctgtggaaaccaaggga
gaaggcccaaggaggctaaagaacctgtacttcttgtacttaattgagctgcgcgcttta
ctgaaggtggccccatacttcgagcgctcaattgtggatctttacactggaaacgtggaa
gacgatgcagacacaaaaaccctcctgctggatatcttccaggacacaaagtcctttccc
atgcactttgatgagaaatccatgttcgcaggtgacaaaaagggggccaaatcgttaaag
gaggaattccggttacatttcaagaatatctctcgtataatggactgcgttggatgtgac
aaatgccgactgtggggaaaactgcagactcagggtttaggaactgcgctgaagatactg
ttctctgaaaaggaaatccagaagcttccagagaatagcccctcaaaaggcttccagctc
actcgacaggaaatcgttgctcttgtaaatgcttttgggaggctttctacaagtataaga
gaattacagaattttaaagtcttattacaacacagtaggtaa

DBGET integrated database retrieval system