KEGG   Miniopterus natalensis: 107525996
Entry
107525996         CDS       T05883                                 

Symbol
EGFR
Name
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04072  Phospholipase D signaling pathway
mna04144  Endocytosis
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05208  Chemical carcinogenesis - reactive oxygen species
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107525996 (EGFR)
   04012 ErbB signaling pathway
    107525996 (EGFR)
   04014 Ras signaling pathway
    107525996 (EGFR)
   04015 Rap1 signaling pathway
    107525996 (EGFR)
   04630 JAK-STAT signaling pathway
    107525996 (EGFR)
   04066 HIF-1 signaling pathway
    107525996 (EGFR)
   04068 FoxO signaling pathway
    107525996 (EGFR)
   04020 Calcium signaling pathway
    107525996 (EGFR)
   04072 Phospholipase D signaling pathway
    107525996 (EGFR)
   04151 PI3K-Akt signaling pathway
    107525996 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107525996 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107525996 (EGFR)
   04520 Adherens junction
    107525996 (EGFR)
   04540 Gap junction
    107525996 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107525996 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107525996 (EGFR)
   04915 Estrogen signaling pathway
    107525996 (EGFR)
   04921 Oxytocin signaling pathway
    107525996 (EGFR)
   04926 Relaxin signaling pathway
    107525996 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    107525996 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107525996 (EGFR)
   05206 MicroRNAs in cancer
    107525996 (EGFR)
   05205 Proteoglycans in cancer
    107525996 (EGFR)
   05207 Chemical carcinogenesis - receptor activation
    107525996 (EGFR)
   05208 Chemical carcinogenesis - reactive oxygen species
    107525996 (EGFR)
   05230 Central carbon metabolism in cancer
    107525996 (EGFR)
   05231 Choline metabolism in cancer
    107525996 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107525996 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107525996 (EGFR)
   05212 Pancreatic cancer
    107525996 (EGFR)
   05225 Hepatocellular carcinoma
    107525996 (EGFR)
   05226 Gastric cancer
    107525996 (EGFR)
   05214 Glioma
    107525996 (EGFR)
   05218 Melanoma
    107525996 (EGFR)
   05219 Bladder cancer
    107525996 (EGFR)
   05215 Prostate cancer
    107525996 (EGFR)
   05213 Endometrial cancer
    107525996 (EGFR)
   05224 Breast cancer
    107525996 (EGFR)
   05223 Non-small cell lung cancer
    107525996 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107525996 (EGFR)
   05171 Coronavirus disease - COVID-19
    107525996 (EGFR)
   05163 Human cytomegalovirus infection
    107525996 (EGFR)
   05165 Human papillomavirus infection
    107525996 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107525996 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107525996 (EGFR)
   01522 Endocrine resistance
    107525996 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107525996 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107525996 (EGFR)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107525996 (EGFR)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   107525996 (EGFR)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107525996 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   107525996 (EGFR)
  Exosomal proteins of bladder cancer cells
   107525996 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like ABC1 APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 107525996
NCBI-ProteinID: XP_016053775
LinkDB
Position
Unknown
AA seq 1154 aa
MLNNCEVVLGNLEITYMQKDYDLSFLKTIQEVAGYVLIALNVVEKIPLENLQIIRGNVLF
ENTHALSVLSNYGPNKTGLRELPMRNLQEILQGAVRFNNNPALCNVDTVQWRDIVDSSFL
SNMSLDFQNTYGNCQKCDPSCPNGSCWGSGKENCQQLTKIICAQQCSGRCRGRSPSDCCH
NQCAAGCTGPRESDCLVCRRFRDEATCKDTCPPLMLYNPTTYQMDVNPDGKYSFGATCVK
KCPRNYVVTDHGSCVRACSSDSREVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINA
TNIQHFRNCTTISGDLHVLPVAFRGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGRFSLAVVGLDITSLGLRSLKEISDGDVIISGNRNLCYAD
TIKWEKLFGTTSQKTKILTNRDGKDCKAQGHICNPLCSSEGCWGPEARDCMSCLNVSRNR
ECVERCNLLEGEPREFVENSECIQCHPECLPQAMNVTCTGRGPDSCVKCAHYMDGPHCVK
TCPAGVMGENSTLVWKFADASHVCHLCHPNCTYGCTGPGPEGCIKPQIPSIAMGIVGGLF
FVLMVALGVGLLLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKI
KVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVNNPHVC
RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEERRLVH
RDLAARNVLVKTPQHIKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQS
DVWSYGVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMIDA
DSRPKFRELINEFSKMARDPQRYLVIQGDERMHLPSPTDSSFYRTLMEEEDMEDLVDADE
YLVPQQGFFHSPSTSRTPLLSSLSATSNTSTVACIDRNGQSCPLKEDSFLQRYSSDPTGA
LTEDNINDTFLPVPEYINQAVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQNPLSNAVDNP
EYLNTVHPPGVNGVPDGPALWVQKGSHQISLDNPDYQQDFFPREAKSNGIFTGPTAENAD
YLRVGPPSSEFIGA
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgctgaacaactgcgaggtggtccttgggaatttggaaattacctacatgcagaaggac
tatgacctttccttcttaaagaccatccaggaggttgccggctatgtcctcattgccctc
aacgtggtggagaagattcctctggaaaacctgcagatcatccgggggaacgtgctcttt
gagaacacccacgccttgtcagtcctgtccaactatggccccaacaaaaccggcctgagg
gagctgcccatgaggaacctgcaggagatcctgcagggcgcggtgcgcttcaacaacaac
ccggcgctctgcaacgtggacaccgtccagtggcgcgacatcgtcgacagcagtttcctg
agcaacatgtcgctggactttcagaacacgtacggcaactgccagaagtgcgacccaagc
tgtcccaacgggagctgctggggttcgggaaaggagaactgtcagcaactgaccaaaatc
atctgtgcccagcagtgttccgggcgctgccggggcaggtcccccagcgactgctgccac
aaccagtgcgcagcgggctgcaccgggccccgcgagagcgactgcctggtgtgccgcagg
ttccgggatgaagccacgtgcaaggacacctgcccgccgctcatgctgtacaaccccacc
acgtaccagatggacgtcaacccggacgggaagtacagcttcggcgccacctgtgtgaag
aaatgcccccgtaactacgtggtgacagaccacggctcctgcgtccgggcctgcagctcc
gacagccgcgaggtggaggaagacggcgtccgcaagtgtaaaaagtgcgaagggccctgt
cgcaaagtgtgtaacgggatagggatcggagagtttaaggacacgctttccataaacgcc
acgaacatccagcacttccggaactgcaccaccatcagcggggacctgcacgtcctgccc
gtcgcctttcggggcgactccttcacacacacgccgcccctggacccaaaggagctggac
attctgaagaccgtgaaggagatcacagggtttctgctgatccaggcctggccggaaaac
aggacggacctccacgccttcgagaacctggagatcatccggggcaggacaaagcagcac
ggccgcttttctctcgcagtcgtcgggctggacatcacgtccctggggttgcgctccctc
aaggagatcagtgatggagacgtgatcatttcgggaaaccggaacctgtgctacgcggac
acaataaaatgggaaaaactgtttgggaccacgagtcagaaaaccaagatcttaaccaac
agagacgggaaagactgcaaggcccaaggccacatctgtaacccgctgtgctcatccgaa
ggctgctggggcccggaggccagagactgcatgtcctgcctgaatgtcagccgcaaccgg
gagtgcgtggagaggtgcaacctcctggagggcgagccccgggagtttgtggagaactcc
gagtgcatccagtgccacccggagtgcctgccgcaggccatgaacgtgacctgcacggga
cggggaccggacagctgcgtgaagtgtgcccactacatggacggccctcactgcgtcaag
acctgcccggccggggtcatgggcgagaacagcacgctggtctggaagttcgcggacgcc
agtcacgtctgtcacctgtgccaccccaactgcacctacggctgtacggggccgggtcct
gaaggctgcatcaagccccagatcccgtccatcgccatgggcatcgtggggggcctcttc
ttcgtgctgatggtggccctcggcgtcggcctgcttctgcgcaggcgccacatcgtccgc
aagcgcacgctgcgccggctgctgcaggaacgcgagctcgtggagcccctgacgcccagc
ggggaggcgcccaaccaagccctcctgaggatcttaaaggagacagaattcaaaaagatc
aaggtgctgggctccggcgccttcggcaccgtgtacaagggcctctggatccccgaaggc
gagaaggttaaaattcccgtggccatcaaggaattaagagaagccacgtctcccaaagcc
aacaaggaaattctcgacgaagcctacgtgatggccagcgtgaacaacccccacgtgtgc
cgcctgctgggcatctgcctgacctccacggtgcagctcatcacgcagctcatgcccttc
ggctgcctcctcgactacgtccgcgagcacaaggacaacatcggctcccagcacctgctc
aactggtgtgtgcagattgccaagggcatgaactacctggaggagcggcggctggtgcac
cgggacctggcggccaggaacgtcctggtgaagacgccgcagcacatcaagatcacggac
ttcgggctggccaagctgctgggcgccgaggagaaggagtaccacgcggaggggggcaag
gtgcccatcaagtggatggccttggaatctattttacaccgaatctacacccaccaaagt
gacgtctggagctacggagtcaccgtgtgggagctgatgacctttgggtccaagccctac
gacgggatcccggcgagcgagatctcgaccatcctggagaagggagagcgcctcccgcag
ccacccatctgcaccatcgacgtctacatgatcatggtcaagtgctggatgatagatgca
gacagtcgccccaaattccgcgagctgatcaacgaattctccaagatggcccgagacccc
cagcgttaccttgtcatccagggcgacgagaggatgcacctgcccagccccacggactcc
agtttctaccgcacgctgatggaagaggaggacatggaggacctggtggacgccgacgaa
tacctggtcccccagcagggcttcttccacagcccctccacctcccggacgcccctcctg
agctccctgagcgcgaccagcaacacctccaccgtggcctgcatcgacagaaacgggcag
agctgtcccctcaaggaagacagcttcctgcagcggtacagctcagaccccaccggcgcc
ctgactgaggacaacatcaacgacactttcctcccagtgccagaatacataaaccaggcg
gtccccaaaaggcccgcaggctctgtgcagaaccccgtctatcacaaccagcctctgaac
ccagctcccagccgagacccccactaccagaaccccctcagcaacgccgtggacaaccca
gagtatctcaacaccgtccatccccccggcgtcaacggagtccctgacggccctgccctc
tgggtgcagaaaggcagccaccaaatcagcctggacaaccctgactaccagcaggacttc
tttcccagggaggccaagtccaatggcatcttcacaggcccgacggccgaaaatgcagac
tacctgagggtaggcccccccagcagtgaatttattggggcatga

KEGG   Miniopterus natalensis: 107527134
Entry
107527134         CDS       T05883                                 

Symbol
IL6ST
Name
(RefSeq) interleukin-6 receptor subunit beta isoform X1
  KO
K05060  interleukin 6 signal transducer
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04630  JAK-STAT signaling pathway
mna04659  Th17 cell differentiation
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107527134 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107527134 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107527134 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107527134 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107527134 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107527134 (IL6ST)
   05203 Viral carcinogenesis
    107527134 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107527134 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107527134 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107527134 (IL6ST)
   04090 CD molecules [BR:mna04090]
    107527134 (IL6ST)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107527134 (IL6ST)
CD molecules [BR:mna04090]
 Proteins
  107527134 (IL6ST)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind fn3_2 Pur_ac_phosph_N ObR_Ig
Other DBs
NCBI-GeneID: 107527134
NCBI-ProteinID: XP_016055269
LinkDB
Position
Unknown
AA seq 908 aa
MSLQAWVVQALLLLLSAGSLGELLDPCGYIDPESPVVQLGSNFTAVCVLTEKCVDYFHVD
ADYIFWKTNHATVPPEQYTVINRTASSVTLTNVSSLSMQLTCNVRTFGQIDQNVYGIRIV
SGLPPEKPRNLSCVVNEGKRMTCQWDPGREPHLETNFTLKSEWATEKFPDCRTKRGSPTT
CTVDYLPVYFVNIEVWVEAENALGKVASDHVNFDPVDRVKPNPPHNLSVSNSEELSSILK
LTWINSGINRFIGLKYDIQYRTRGTSAWSQIPQEDTASTRYSFTVQDLRPFTEYVFRIRC
MKEDGRGFWSDWSEEASGTTYEDRPSKAPSFWYKVEPSPTPGYRSVRLIWKTLPPFEANG
KILDYEVTLARWKSPVQNYTVRDTQLTVNLTNDRHKATLTARNLVGTSDAAVLTIPACDF
QATRPVRDLKAFPKDNMLWVEWAPPEVPVNKFVLEWCVLSDKAPCVPDWQQEEGTVHLTH
LTGNLAESKCYLITVTPVYSDGPGSPASIKAYLKQAPPSKGPTVRTKKVWKNEAVLEWDQ
LPVDVQNGFIRNYTIFYKTNIGNETAVNVDSSHTEYTLSSLSSDTLYMVRMAAYTDEGGK
DGPEFTFTTPKFAQGEIEAIVVPVCLAFLLITLLGVLFCFNKRDLIKKHIWPNVPDPSKS
HIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKAFPEDLKALDLFRKEKTST
EGHSSGIGGSSCMSSRQSLSSGDESESAQSAASAVQYSTVVHSGYRHQAPSMQVFSRSES
TQPLLDSEERPEELQLVDSVDGVLPRQPYFKQNCGQQEPGSDSAQSERPWPVPAGEEDGA
RLTQQLSGPVTQACGSGQMQVFQEVPAVDAFGPGTEGLETVGTEAVLDEGLPKSYLPQTV
RRGGYMPQ
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgtcactgcaggcgtgggtggtgcaggccttgctgctgctactcagcgcgggatcccta
ggtgaacttctggatccgtgtggttacattgaccccgagtctccggttgtacagctcggt
tccaatttcactgcggtctgtgtgctaacggagaaatgcgtggattacttccacgtcgat
gccgactacatcttctggaagacaaaccatgccacggtgcctcccgagcagtacaccgtc
ataaacagaacagcgtccagcgtcacactcacaaacgtgtcctcgctgagcatgcagctc
acctgcaacgtccgcaccttcgggcagatcgatcagaatgtctatggcatcagaatcgtc
tcaggcttgcctccagaaaagcccaggaatctgagctgcgttgtgaacgaggggaagaga
atgacatgccagtgggaccccgggcgggaaccgcacctggagacgaacttcaccctgaag
tccgaatgggcaacagagaagtttcccgattgtagaacgaaacgcggcagccctaccacc
tgcactgtcgactacctgcctgtgtattttgtcaacattgaagtctgggtggaagcggag
aacgcccttgggaaggttgcctcagaccacgtcaactttgaccctgtggatagagtgaag
cccaatccaccacataatttatcagtcagcaactcagaggagctgtccagtatcctaaag
ctgacatggatcaactcaggtattaacagattcataggactgaagtacgacattcagtac
aggaccagaggcacctcggcctggagccagattcctcaggaagacacagcctccacccgg
tactcgttcaccgtccaggacctccggccgttcacggagtacgtgttccggattcgctgc
atgaaggaggacggcaggggcttctggagcgactggagcgaggaggcgagcgggaccacc
tacgaggaccgaccatccaaggcgccgagtttctggtataaggtagagccgtcccctact
cctggctacagatccgtgcggctcatctggaagaccttgcccccttttgaagccaacggg
aaaatcttggattatgaagtgactcttgcaaggtggaagtcacctgtacagaactacacc
gtccgggacacacagctgacagtgaacctcaccaatgaccgccacaaagcaaccctcacg
gccagaaacctggtcggcacgtcagacgcggctgtgttaaccatccccgcctgtgacttc
caagctactcgccccgtaagggaccttaaagcgtttcccaaagacaacatgctgtgggtg
gagtgggctccccccgaggtgcctgtgaacaagttcgtgcttgagtggtgtgtgctgtcg
gacaaggcgccctgcgtcccggactggcagcaggaggagggcaccgtgcacctcacccac
ctcacagggaacctggccgagagcaagtgttacctgatcaccgtgaccccagtgtacagc
gacgggccaggcagccccgcgtccatcaaggcctacctcaagcaggccccaccttccaaa
ggacccactgttcggacaaagaaagtgtggaaaaacgaagccgtcttagagtgggaccag
cttcctgtcgatgttcagaatgggttcatcagaaattacacaatattttacaaaaccaac
attggaaatgaaaccgccgtgaacgtggactcgtcccacacggagtacacgctgtcctcg
ctgagcagcgacaccctgtacatggtgcgcatggccgcgtacacggacgagggcgggaag
gacggccccgagttcaccttcaccacccccaagtttgctcaaggagaaatcgaagccatc
gtggtgcctgtctgcctggcgttcctgttgataaccctcctgggggtgctgttctgcttt
aacaagcgagacctaattaagaagcacatctggcccaatgtccctgatccgtccaagagc
cacattgcccagtggtccccgcacacgccgcctcggcataactttaactcgaaagaccag
atgtactcggatggcaacttcaccgacgtgagtgtcgtggagatagaagcaaacgacaag
aaggcctttccggaggacctgaaggccctggacctgttccggaaggagaagaccagcacc
gagggccacagcagcggcattgggggctcctcctgcatgtcctccaggcagagcctgtcc
agcggcgacgagagcgagtccgcgcagagcgcagccagcgcggtgcagtactccaccgtg
gtgcacagcggctaccggcaccaggcgccctccatgcaggtcttctcgcgctcggagtcc
acgcagcctctgctggactccgaggagcggcccgaggagctccagctggtggacagcgtg
gacggcgttctgcccaggcagccgtatttcaagcagaactgcggtcagcaggaacccggc
tcagacagtgcgcagtcggagaggccgtggccggtccccgccggcgaggaagacggcgcc
agactcacgcagcagctttcgggccccgtcacccaggcctgcgggtcggggcagatgcag
gtgtttcaggaggtccctgcagtagatgctttcggtccagggactgaggggctggaaacg
gttgggacggaggctgtgctcgatgaagggctgccgaaaagttacctgccacagacagtg
aggcggggcggctacatgccccagtga

KEGG   Miniopterus natalensis: 107529138
Entry
107529138         CDS       T05883                                 

Symbol
IL5RA
Name
(RefSeq) interleukin-5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107529138 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107529138 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107529138 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529138 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107529138 (IL5RA)
   04090 CD molecules [BR:mna04090]
    107529138 (IL5RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL3 receptor family
   107529138 (IL5RA)
CD molecules [BR:mna04090]
 Proteins
  107529138 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Tissue_fac EpoR_lig-bind PepX_C Interfer-bind
Other DBs
NCBI-GeneID: 107529138
NCBI-ProteinID: XP_016057928
LinkDB
Position
Unknown
AA seq 450 aa
MTVPPTVHRAGDPGKRRAPGTGQQRGAEAGPDLIAMAPTLLMLLGATAILRADALPDTNS
SLLPPVNFTVQVTGLAQVLLSWAPNPDQEQRSVRLGYHVRIRGPEEEDYQTRNTESKRVT
TLHGGLRASVRTIPWEHPAAPASRWVSAELPAPPGSPGTSAANLTCSTHTAGSPGTRSRP
YQVSLRCSWRAGEAAPEDTRYSLYYRYGSRTEECQEYRQDGLRRNVACWFPRTAIDGKGR
DWLAVLVNGSSARAAIRPLDRLFALHAIDQVNPPGNVTAEMEGTRLSIEWEKPVSAFPAH
CFDYEVKIHSTGTGYFQTGKMTTNKFTSTISDVSKYCVEVRAAVSSVCRETGLWSEWSEP
IYVGNERTPWTEWYLISLVAATCSAFSLLLACKTCHLWTKLFPPVPAPKSNIKDFATTAD
YEKTGSGETESEIISYVEEQGLEALEDLVF
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgacagtgcccccgacggtgcaccgggccggtgacccgggcaaacgccgcgctccgggg
acgggccagcagcgaggtgcggaagccgggccagatctgatcgccatggcacccacatta
ctgatgcttttgggagccaccgcgatcctgcgagcagacgcacttcccgatactaattcc
tcccttctcccgcccgtgaacttcaccgtgcaagtcacgggtctggcgcaagttctcctc
agctgggccccgaatcccgaccaggagcagaggagcgtccggctgggctaccacgtgagg
atccgcggacccgaagaggaagactaccagaccaggaacacggagagcaagcgcgtgacc
acgctccacgggggcctgcgggccagcgtgcggaccatcccctgggagcacccggcggcc
ccggccagccgctgggtgtcggctgagctgccggcccccccagggtctccgggaacctcg
gccgcgaacctgacctgcagcacgcacacggcaggaagccccgggacgcgctcccggccc
taccaggtctccctgcgctgcagctggcgggcgggcgaggcggcccccgaggacacgcgc
tattccctctactacaggtacggctcgcggacggaggagtgccaggagtaccggcaggac
ggcctgcgcaggaacgtcgcctgctggttccccaggacggccatcgacggcaaagggcgg
gactggctcgcggtgctggtcaacggctccagcgcccgcgcggccatccggcccctcgac
cggctgtttgctctccacgccatcgatcaagtgaaccctccggggaacgtcacggcggag
atggaagggacccggctctccatcgagtgggagaagcccgtttccgccttcccggcccac
tgctttgactacgaagtgaagattcacagcacggggacgggctactttcagacagggaaa
atgacgaccaataaattcacctccacgattagtgacgtttctaagtattgcgttgaagtg
agagcagcggtgagctccgtgtgcagggagacggggctctggagcgagtggagcgaaccg
atctacgtgggaaacgagcggacgccctggaccgagtggtacctgatctcgctcgtggca
gccacctgttctgcgttctccctgctgctcgcctgcaagacgtgtcacttatggaccaag
ctgtttccaccagttccagccccaaaaagtaacatcaaggattttgccacaaccgccgac
tatgagaagacgggttcgggtgagacggaaagtgaaatcataagctacgtggaagagcag
gggctcgaggccctggaggacttggtgttctga

KEGG   Miniopterus natalensis: 107529345
Entry
107529345         CDS       T05883                                 

Symbol
IL13RA1
Name
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107529345 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107529345 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529345 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107529345 (IL13RA1)
   04090 CD molecules [BR:mna04090]
    107529345 (IL13RA1)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL3 receptor family
   107529345 (IL13RA1)
CD molecules [BR:mna04090]
 Proteins
  107529345 (IL13RA1)
SSDB
Motif
Pfam: IL6Ra-bind LIFR_N EpoR_lig-bind LIFR_D2
Other DBs
NCBI-GeneID: 107529345
NCBI-ProteinID: XP_016058189
LinkDB
Position
Unknown
AA seq 316 aa
MLVEKCISPPEGDPESAVTELQCIWHNLSYMKCTWLPGRNTSPDTNYILYYWHSSLGKIL
QCENIYREGQHISCSFTLTKVKDSGFDQHSVQVMVKDNAGKIRPSFNIVPLTSRVQPDPP
HIKRLFFQHGDLYVLGKNPQNFGSNCLSYQVEVNNSQTEMHYILSVEEPICDNSEFERNV
EGTICFRVPGVLPDTLNTVRMRVKTNKLCYEDNKLWSNWSPAMSIGKKTNPILYITMLLI
IPIIVAGAIIVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKE
ETDSVVLIENLKRTPQ
NT seq 951 nt   +upstreamnt  +downstreamnt
atgttggttgaaaagtgcatctcgccccctgaaggtgatcctgagtcagctgtgactgag
ctacaatgcatttggcacaacctgagctacatgaagtgcacttggctccctggaaggaat
acaagtcctgatactaactatattctctattactggcacagcagcctggggaaaattctt
cagtgtgaaaacatctatagagaaggtcaacacattagttgttcttttactctgactaaa
gtgaaggattccggttttgaccagcacagtgttcaagtgatggtcaaggataatgcagga
aaaattagaccatccttcaatatagtgcctttaacttctcgtgtgcaacctgatcctcca
catattaaaaggctcttcttccaacatggtgacttatatgtgctaggcaagaacccacag
aattttggtagcaattgtttatcttatcaagtagaagtcaataacagccaaactgaaatg
cattatatcttatccgttgaagaacccatatgtgataattcagaatttgagaggaacgta
gagggtacaatttgtttccgggttcctggtgttcttcctgatactttgaacacagtcaga
atgagagtcaaaacaaataagttatgctacgaagataacaaactctggagtaattggagt
ccagcgatgagtataggtaagaagaccaatcccatactctacatcaccatgttactcatc
attcccatcattgttgcaggtgccatcatagtccttctgctttatctaaaaaggctcaag
atcattatattccctccaattcctgatcctggaaagatttttaaagaaatgtttggagac
caaaatgatgataccttgcactggaagaagtatgacatctatgagaagcaaaccaaagaa
gaaacagattctgtcgtgctgatagaaaacctaaagagaacccctcagtaa

KEGG   Miniopterus natalensis: 107530781
Entry
107530781         CDS       T05883                                 

Symbol
IL10RA
Name
(RefSeq) interleukin-10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04630  JAK-STAT signaling pathway
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107530781 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107530781 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107530781 (IL10RA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107530781 (IL10RA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107530781 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107530781 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107530781 (IL10RA)
   04090 CD molecules [BR:mna04090]
    107530781 (IL10RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL10/28 receptor family
   107530781 (IL10RA)
CD molecules [BR:mna04090]
 Proteins
  107530781 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac
Other DBs
NCBI-GeneID: 107530781
NCBI-ProteinID: XP_016060179
LinkDB
Position
Unknown
AA seq 638 aa
MCPVRQDPGGEKETQRGRGGVNSEDGALEDSEEWPFTTGAKRPKEALQSKVASVTSQDGI
ETYKFTCVCREGPRGPGLSHSSPGTELPSPPSVWFEAEFFHHILHWTPIQNQSESTYYEV
QLLRYGIGPWTPISSCSQTLMLSCDLTMVTLDLYHSNGYRAKVRAVDRGQHSNWTVTNTR
FTKDEVNLTVGSVELEIRDGIVLGKIKPPRPKVAPAGETYESIFPHFREYEIAIRKVPGH
YKLTNKRVAHENFSFPSPGEVGEFCVKVKPAVSSLTNKGLWSEEACFMLTWHYFTVTNLS
IFCILVVLLCGALAYSLTLQLYVRRPRKLPAVLVFGRPSPFSLFGQLPGLETLDSICALS
EEALPKVSAGLRNSELHGSTDSGFGSAKPSLQTEEPQFLLPALHPPCGGTLGKGASLELE
SSGSSGSSDSGICLQEPSLSPRSAPSWEPPVGTRGQGQDDSGIGLIHGSEGQPGDTQDGS
ALGRVSPLGHEMTEEEGPAAVAFQGYLQQTRGTEEKAAEAGCLEEESSSTGGLDPQLGVC
LDAEEAWPPPVLVKGYLKQDPPEVTLTPSGAPAGQGNPQTEEWSLLGLASYGDLGTSDWS
FAHDLAPLDCVAAPGSLLGSFDSDLVILPLISSLHSSE
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgtgccctgtgaggcaagaccctggtggcgagaaggagacgcagagagggcggggaggc
gtgaacagtgaggacggcgcactggaggactccgaggaatggcccttcaccactggggcg
aagcgtccgaaagaggccctgcagagcaaggtggccagcgtgacttcgcaggacggaatc
gagacgtacaagttcacctgcgtgtgcagggaggggccgcgtggccccgggctttcccac
tcctccccagggacagagctgcccagccccccatctgtgtggtttgaagcagagtttttc
caccacatcctccactggacgcccatccagaatcagtctgaaagtacctactatgaagtg
cagctcctacggtacgggatagggccctggacgcccatctccagctgtagccagaccctg
atgctgtcctgtgacctcaccatggtgaccctggacctgtaccacagcaatggctaccga
gccaaagtccgggctgtggacagaggccagcactccaactggactgtcaccaacactcgc
ttcaccaaggacgaagtgaatttgacagttggcagcgtggagctcgagatacgtgatggc
atcgtccttggaaagataaagccaccccggcccaaggtggcccctgcaggcgaaacgtac
gaaagcatcttcccacacttccgagaatatgagattgcaattcgcaaggtgccaggacac
tataagctcacaaacaagagggtagcacatgaaaacttcagcttcccgagccctggagag
gtgggagagttctgtgtcaaggtgaaaccggccgtgtcatccctaacgaacaaggggctg
tggtcggaggaggcgtgcttcatgctcacctggcattacttcaccgtgaccaacctcagc
atcttttgcatcctcgtggtgctgctgtgcggggccctggcctactccctgaccctccag
ctgtacgtgcggcgccccaggaagctgcctgccgtcctggtcttcgggaggcccagcccc
ttcagcctcttcggccagcttcccggcctagagaccctagactccatctgtgccctcagc
gaggaggccttgcccaaggtgtccgcagggctgaggaactcggagctgcatggcagcacg
gacagcggcttcggcagtgccaagccatcgctgcagactgaggagccccagttccttctc
cccgccctgcaccccccgtgcgggggcacgctgggaaagggggcctccctggagctggag
agcagcggcagcagcggcagcagcgacagcggcatctgcctgcaggagcccagcctcagt
ccccgctcggcacccagctgggagccgccggtgggcacccgtggccagggccaggatgac
agtggcatcggcctcatccacggctctgaagggcagcctggggatacacaggatggctca
gccttgggccgtgtcagccccttggggcatgagatgactgaggaagaaggcccggctgcg
gtggcatttcagggctacctgcagcagaccagaggcacggaggagaaggcagccgaggca
ggctgcctggaagaagagtcctcctcaacaggtggcctcgacccccaactcggggtgtgc
ctggatgccgaggaagcctggcctccaccagtcctggtcaagggctatttgaaacaggat
cccccagaagtgactctcactccctcaggggccccagctggacaggggaacccccaaact
gaagaatggtcactcctgggcttggccagctatggtgacctaggaacatctgactggagc
tttgcccatgatcttgcccctctggactgtgtggcagccccgggcagtctcctgggcagt
tttgactcagacctggtcatcctgccactgatctccagtctgcactccagtgagtga

KEGG   Miniopterus natalensis: 107530946
Entry
107530946         CDS       T05883                                 

Symbol
IL22RA2
Name
(RefSeq) interleukin-22 receptor subunit alpha-2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
mna  Miniopterus natalensis
Pathway
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107530946 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107530946 (IL22RA2)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL10/28 receptor family
   107530946 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 107530946
NCBI-ProteinID: XP_016060366
LinkDB
Position
Unknown
AA seq 231 aa
MAPKHCFLGFLITGFLTGAVETHPAHKSLMPQRVHFQSRNFHNILHWQPGRACASNSCIY
FVQYKMYGQKQWKNKEDCWGIQEFFCDLTDETSDVQEAYYGRVRTGVAGTHSSWTMTQRF
TPWWETKIDPPVMNITQVNGSLLVILHAPNIPYRNQNGKNVSMENYYELVYRVFIINNSL
EKEQKVYEGARRVVEIEAVTPHTGYCAVAEIYQPVLGRRSQRSQERCVRVP
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcgcctaaacactgcttcctaggcttcctcatcaccggcttcctgactggtgcagta
gaaactcacccagcccataagtctctgatgcctcagagagtacatttccagtcccgaaat
tttcacaacattttgcactggcagcctgggagggcttgtgccagcaacagctgcatttac
tttgtgcaatataaaatgtacggacagaaacagtggaaaaataaagaggactgttggggt
attcaagaattcttttgtgaccttaccgatgaaacctcagatgtacaggaggcttattac
ggaagggtgaggaccggcgtggctgggacccactcaagctggaccatgacacagcggttc
actccctggtgggaaacaaaaatagatcctccagttatgaatataacccaagttaatgga
tccttgttggtgattctccatgctccaaatataccatatagaaaccagaacggaaaaaat
gtatccatggaaaattactatgagctagtataccgagtctttataattaacaattcacta
gaaaaggagcaaaaggtatatgaaggagcccgcagagtggttgaaatcgaagctgtcacg
cctcacacgggttactgcgcggtggccgaaatctaccagcccgtgctgggcaggagaagt
cagaggagccaagagcgatgcgtgcgagttccttaa

KEGG   Miniopterus natalensis: 107530947
Entry
107530947         CDS       T05883                                 

Symbol
IL20RA
Name
(RefSeq) interleukin-20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107530947 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107530947 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107530947 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107530947 (IL20RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL10/28 receptor family
   107530947 (IL20RA)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 107530947
NCBI-ProteinID: XP_016060367
LinkDB
Position
Unknown
AA seq 501 aa
MKNILQWSPPEDLQGEVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYA
KVKAIWGTNCSKWAETGRFYPFLETQIGPPEVALTADEKSISVVLTAPEKWKTNPEESSI
SMQQIYSNLKYNVSIYNTRSNRTWSQWVTNDTLLLSWLEPDTLYCVRVESFIPAPPRLAQ
PSEEQCVSTLKDQTAALKIKIIFWYVLPISVTVFLFSVMGFSVYRYIHVGKEKHPANLIL
IYGNELDKRFFVPAEKIVINFITLNILEDSKISHKDINIMEKSNDVSDLPEPSRDQEPHQ
EEMEVKHLGYASHLMDFFCDSEESSKETSLTQQEPLSRTIPTDKIVIEYEYNVRTTDISV
RPGDQELSLQEELFPQGKLFEQQAALADSGPQTLLYSYIPQLRDLGHLPKEHVDPEEGPE
EDPSTTLVDWDPQTGRLRIPSLSSFEHDSEGCEHPEYKELADEGLLSRLYDEQAPDKPLE
EDKTYLMQFLEEWELYVQMED
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaagaatatcctccagtggagtccaccagaggacctgcaaggagaagttacttatact
gtgcagtatttcatatatgggcaaaaaaaatggctgaataaatccgaatgcagaaatatc
aataggacctactgtgatctttctgctgaaacctctgactatgagcatcaatattatgcc
aaagttaaggccatttggggaactaattgttccaaatgggccgaaactggacgattctat
cctttcttagaaacacaaattggcccaccagaggttgctttgactgctgatgagaaatcc
atttctgttgttctgacggcaccagagaagtggaagacaaatccagaagaaagttccatt
tccatgcaacaaatatactctaatctgaagtataatgtgtccatatataacactagatca
aacagaacgtggtctcagtgggtgaccaacgacacgctgctgctcagctggctggagccg
gacactctgtactgcgtccgcgtggagtccttcatcccagcacctcctcgcctcgctcag
ccttccgaggagcagtgtgtcagtactttgaaagatcaaacagcagcattgaaaattaaa
atcatcttctggtatgttttgcccatatctgttactgtgtttctcttttctgtgatgggc
ttctccgtgtacagatacatccatgttggcaaagagaaacacccagcaaatctgattttg
atttatggaaatgaacttgacaaaagattctttgtacctgctgaaaaaattgtgattaac
tttatcaccctcaatattttggaggattctaaaatttctcataaggatataaatatcatg
gagaaaagcaatgatgtatcggacctgcctgagcccagcagggaccaggagccccatcag
gaggaaatggaggtgaagcacttagggtatgcttcacatttgatggactttttctgtgac
tctgaggaaagctccaaggagacttccctgacccagcaagagccactcagcagaacaata
cccacagataaaatagtcattgaatatgaatataatgtgagaactaccgacatttctgtg
aggcctggagatcaagagcttagtttgcaggaggagctgttcccacaaggaaaattattt
gagcaacaggcagctttggcagactcgggtccacaaacactactgtattcatatatccct
caactcagagacttgggccacctcccaaaggagcatgtggacccagaagaggggccagaa
gaagacccatcgaccacactggtcgattgggaccctcagactggcaggctgcgtatacct
tcattatccagctttgaacatgactcagaaggatgtgagcaccctgagtacaaggagctc
gcagatgagggccttttgtctagactctacgacgagcaggctccagacaagccactggaa
gaagacaaaacctatctgatgcaattcttggaggaatgggaattatatgtacaaatggaa
gactaa

KEGG   Miniopterus natalensis: 107530983
Entry
107530983         CDS       T05883                                 

Symbol
IFNGR1
Name
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04066  HIF-1 signaling pathway
mna04217  Necroptosis
mna04380  Osteoclast differentiation
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05164  Influenza A
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05200  Pathways in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107530983 (IFNGR1)
   04066 HIF-1 signaling pathway
    107530983 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107530983 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107530983 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107530983 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    107530983 (IFNGR1)
   04659 Th17 cell differentiation
    107530983 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107530983 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530983 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107530983 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    107530983 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    107530983 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107530983 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107530983 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107530983 (IFNGR1)
   05140 Leishmaniasis
    107530983 (IFNGR1)
   05142 Chagas disease
    107530983 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107530983 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107530983 (IFNGR1)
   04090 CD molecules [BR:mna04090]
    107530983 (IFNGR1)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IFN receptor family
   107530983 (IFNGR1)
CD molecules [BR:mna04090]
 Proteins
  107530983 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 107530983
NCBI-ProteinID: XP_016060404
LinkDB
Position
Unknown
AA seq 479 aa
NKYFYIWLTWLLIIRFANVNVNFLLLSILLFESLTVPVPTNVIIEAYHFDTVLSWNYPVM
PQKPVFTAQVKNYGKEWVDACNTSNHHCNIFDMINMPNDPIWARVKARLGQKESAYAESE
EFNLCRKGKFGPPKLGIRHKEDRIIIDVFHPLIIVKEEVRGTMYHVSDCYTFTYKVYVRI
NGSLMIETKNVQNEDDCNETQCHFSIPVPSLNSEYCIAAEGVTDAWSVTTERSKELCINI
SDHKSTEDPVWIPIIAALLLFVVILVLVCYVIKKINPFKRESIMLPKSLVSVVKSASSEV
KSESKYVSPITYEPIVLENEKVIWEEQPSPATVSSMQTEDHPGKVEPREDLCSETEVGDT
EENIPDIAPGSPLTPVKRGDFVHSGSNQSEPCSVALNSYHLGNGSDSGLVESDSLSDSEF
PPSSKTEIKTGEPEPIMLRNTTTSFGYDKPHVLVDLLVDEGGKESLIGYRVTEASSEFS
NT seq 1440 nt   +upstreamnt  +downstreamnt
aacaaatatttttatatttggttaacatggcttcttattataaggtttgctaatgttaat
gttaatttcttactattgtccattttactttttgaatctcttacagtgcctgttccaacc
aatgttataattgaggcctaccactttgatacagtcctatcttggaattacccagtcatg
ccgcagaagcctgtttttactgcgcaggtgaagaactatgggaaagaatgggttgatgcc
tgcaatacctctaatcatcactgtaatatctttgacatgattaatatgccaaacgatcct
atctgggcaagagttaaagctagacttggacaaaaagaatcagcctatgcagagtcggaa
gaatttaatttgtgccgcaaagggaaatttggaccacctaaactgggtatcagacataag
gaagacagaatcattattgatgtatttcatcctttaattattgtaaaggaagaagtgcgg
ggaaccatgtatcatgttagtgactgttacacattcacgtacaaggtgtatgtgagaata
aatggaagtctgatgatagaaacaaagaatgtacagaatgaagatgattgcaatgagact
cagtgccacttcagtatcccagtgccctcactgaattctgagtactgcattgcagcagaa
ggagtcacagatgcatggtctgttacaacagaaaggtccaaagaactttgtattaacatt
tctgatcataagagcacagaagatcctgtttggattccgattattgctgctctcctcctc
tttgtagtcattctggtgctcgtatgttatgtcattaagaagataaatccatttaagaga
gaaagcatcatgttacccaagtccttggtgtctgtggtaaaaagtgcctcttcagaggta
aaatctgaatcaaaatatgtatcacccatcacctatgaaccaattgtccttgagaatgag
aaggtgatctgggaagagcagccatctccagcaacagtttcaagtatgcagactgaggac
catccaggaaaagtagaacctagagaagatctttgtagtgaaacagaagtgggagacact
gaagaaaatattcctgacattgcccctggtagccctctgaccccagtaaagagaggggat
tttgtccattcaggtagtaaccagtctgaaccctgcagcgtcgctttaaactcttatcac
ttgggaaatggttctgatagtggccttgtggaatcagacagtttatctgactcagaattt
cctccaagcagcaaaactgaaataaagacaggagaaccagagcccataatgctgagaaac
actaccacctcctttggttacgataagccccacgtgctagtggacctgcttgtggatgaa
ggtggtaaagagtccttgattggctacagagtcacagaagcttccagtgagttttcataa

KEGG   Miniopterus natalensis: 107532710
Entry
107532710         CDS       T05883                                 

Symbol
PDGFRA
Name
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04144  Endocytosis
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107532710 (PDGFRA)
   04014 Ras signaling pathway
    107532710 (PDGFRA)
   04015 Rap1 signaling pathway
    107532710 (PDGFRA)
   04630 JAK-STAT signaling pathway
    107532710 (PDGFRA)
   04020 Calcium signaling pathway
    107532710 (PDGFRA)
   04072 Phospholipase D signaling pathway
    107532710 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    107532710 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107532710 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107532710 (PDGFRA)
   04540 Gap junction
    107532710 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107532710 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532710 (PDGFRA)
   05206 MicroRNAs in cancer
    107532710 (PDGFRA)
   05230 Central carbon metabolism in cancer
    107532710 (PDGFRA)
   05231 Choline metabolism in cancer
    107532710 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    107532710 (PDGFRA)
   05218 Melanoma
    107532710 (PDGFRA)
   05215 Prostate cancer
    107532710 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107532710 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107532710 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107532710 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107532710 (PDGFRA)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107532710 (PDGFRA)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107532710 (PDGFRA)
CD molecules [BR:mna04090]
 Proteins
  107532710 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE Ig_6 C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 107532710
NCBI-ProteinID: XP_016062673
LinkDB
Position
Unknown
AA seq 1102 aa
MTRKAETLFQFSRAMGTSHLALLVLGCLLAGPRRGLCQLPLPSILPNENEKVVQLNSSFS
LRCFGESEVTWQYPMSDEDPNVKIRSEENNSGLFVTVLEVANASAAHTGLYTCYYNHTQT
KDSEVEGSHIYIYVPDPDVAFVPLGMTDYLVIVENDDFAVIPCRTTDPQTPVTLLSSDGV
VLADYDSRQGFNGTFTGGPYICEAIVRGKKFQTIPFNIYAVTATSELDLELEAPKTVYKS
GETIVLNCIVFNNEVVDLRWTYPGEVKNKGVIMLEEIKDPSIKLVYTLMVPKATVKDSGD
YECVARLTTREVKEMKKVTISVHEKGFIEIQPSFSQLEAVNLHEVKHFVVDVQAYPPPRI
SWLKDNLTLIENLTEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDMKTYTF
ELLTQVPSSIVDLVDDHHGSSGGQTVRCTAAGTPLPDIEWLICKDIKRCNNETSWATLAN
NISNIITEVYALDRSMVEGRVTFAKVEETIAVRCLAKNLLGVENRELKLVAPTLRSELTV
AAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWE
FPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKTKKELDI
FGLNPADESTRSYVVLSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPAS
YKKKSVLDSEVKDLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLA
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEIYEIMVKCWNSEPEKRPSFYHLR
EIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGL
DEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETI
EDIDMMDDIGIDSSDLVEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgactcggaaggcagaaactttgttccagttttccagagctatggggacttcccatctg
gcactcctggtcctaggctgtctcctcgcagggccccggcgaggcctctgccagctccct
ctgccctccatcctcccaaacgagaacgagaaggtcgtgcagctgaactcgtcgttctct
ctgagatgcttcggggagagcgaagtgacctggcagtaccccatgtcggacgaggacccc
aatgtgaagatcaggagcgaggagaacaacagcggcctttttgtgacggtgctggaggtg
gccaacgcctcggcggcccacacgggcctgtacacctgctattacaaccacacgcagacc
aaggacagcgaggtcgaaggcagccacatttacatctacgtgccagacccggatgtagcc
tttgtgcctctaggaatgactgattacttggtcatcgtggagaacgatgattttgctgtt
ataccttgccgcacgactgacccgcagactccggtgaccttgctgagcagtgatggggtg
gtcctggctgactatgacagcagacagggcttcaacgggaccttcactggtgggccctat
atctgtgaggccatcgtcagagggaagaagttccagaccattccatttaacatttatgct
gtaacagcaacatcagaacttgatctagaactggaagctcctaaaactgtatataagtcg
ggggaaacaattgtgctcaactgcatcgtctttaacaatgaggtggttgaccttcggtgg
acttaccctggagaagtgaaaaacaaaggcgtcataatgctggaggaaatcaaggaccca
tccatcaaattggtgtacaccctgatggtccccaaggccacggtgaaagacagtggagat
tacgaatgcgttgcccgcctgaccaccagggaggtcaaagaaatgaagaaagtcaccatt
tctgtccatgagaaagggttcattgaaatccaacccagcttcagccagttggaagctgtc
aacctgcatgaagtcaaacattttgtggtggatgtgcaggcctaccccccgccccggata
tcctggctcaaggacaacctgaccctcatcgaaaacctcaccgagatcaccaccgacata
gaaaagatccaggagataaggtaccgaagcaaattgaagctgatccgtgctaaggaagaa
gacagtggccattacactatcgtagttcaaaacgaagatgacatgaagacctacactttc
gaactcttaactcaagttccctcatctattgtggacttggtggacgaccaccacggctct
tcagggggacagactgtgaggtgcacagcggcagggacgcctctccctgacattgagtgg
ttgatctgtaaggacattaagagatgtaataatgagacttcgtgggcaactctggccaac
aacatctcaaacatcatcacggaggtctacgccctagacaggagtatggtggagggccgg
gtgacattcgccaaagtagaggagaccattgcagttcgatgtctggctaagaatctcctt
ggggttgagaatcgagagctaaagctggtggctcccactctgcgctctgagctcacggtg
gcagccgcagtcctggtgctgttggtgattgtgatcatctcactgattgtcctggttgtc
atttggaaacagaaaccaaggtatgaaattcgctggagggtcattgaatctatcagcccc
gatggacatgaatatatttatgtggacccgatgcagctgccttatgactcgagatgggag
tttccaagagatggactagtgctgggtcgaatcctgggatctggtgcgtttggtaaagtg
gttgaaggaactgcctatggattaagccggtcccaacctgtcatgaaagtagcagtgaag
atgcttaaacccacagccagatccagtgaaaaacaagctctcatgtctgaactgaagata
atgacccacctggggccacatttaaacattgtcaacttgctgggagcctgtaccaagtca
ggccccatttacatcatcaccgagtactgcttctatggggatttggtcaactatttgcat
aagaatagggacagcttcctgagccaccacccagagaagacaaagaaagagctggacatc
tttggattgaaccctgctgatgaaagcacacggagttatgttgttttatcttttgaaaac
aatggtgactacatggacatgaagcaagctgacaccacacagtacgtccccatgctggaa
agaaaagaagtttctaaatactcggacatccagaggtccctgtatgaccgcccagcctcg
tacaagaagaagtctgtgttagactcagaagtcaaagacctcctttcggatgataactcg
gaaggcttgactctgttggatttgttgagcttcacctatcaagttgcccgaggaatggag
tttttggcttcaaaaaattgtgtccaccgggacctggccgctcgcaacgtcctcctggca
caaggaaaaatcgtgaagatctgtgactttggcctggccagagacatcatgcatgattcg
aactacgtatcaaaaggcagcaccttcctccccgtgaagtggatggctcctgagagcatc
ttcgacaacctctacaccacgctgagtgatgtctggtcttacggcattctgctctgggag
atcttttccctcggtggcacaccctaccctggcatgatggtggattctactttctacaat
aagatcaagagtgggtaccggatggccaagccagaccacgccaccagtgaaatctacgag
atcatggtgaagtgctggaacagcgagccagagaagagaccctccttttaccatctgaga
gagattgtggagaacctgctgcctggacagtataaaaagagttatgaaaagattcacctg
gatttcctgaagagcgaccatcccgccgtggcacgcatgcgagtggatgctgataatgcc
tacattggcgtcacctacaaaaatgaagaggacaagctgaaggactgggagggtggcctg
gatgagcagaggctgagtgctgacagcggctacatcattcctctgcctgacattgaccct
gttcctgaggaggaagacctgggcaagaggaacagacacagctcgcagacatctgaagag
agtgccattgagacaggttccagcagttctaccttcatcaagagagaagacgagaccatt
gaggacatcgacatgatggatgacattggcatagactcctcagacctggtggaggacagc
ttcctttaa

KEGG   Miniopterus natalensis: 107532895
Entry
107532895         CDS       T05883                                 

Symbol
IL2RG
Name
(RefSeq) cytokine receptor common subunit gamma isoform X1
  KO
K05070  interleukin 2 receptor gamma
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04144  Endocytosis
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05321  Inflammatory bowel disease
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107532895 (IL2RG)
   04151 PI3K-Akt signaling pathway
    107532895 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107532895 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107532895 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107532895 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107532895 (IL2RG)
   04659 Th17 cell differentiation
    107532895 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532895 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107532895 (IL2RG)
   05162 Measles
    107532895 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107532895 (IL2RG)
   05340 Primary immunodeficiency
    107532895 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107532895 (IL2RG)
   04090 CD molecules [BR:mna04090]
    107532895 (IL2RG)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107532895 (IL2RG)
CD molecules [BR:mna04090]
 Proteins
  107532895 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 107532895
NCBI-ProteinID: XP_016062906
LinkDB
Position
Unknown
AA seq 369 aa
MLKKPLPLRFLLFLQLLLLGIGLTSTVLTSNGNEDITADFFLTSTPPGTLNVSTLPLPEV
QCFVFNVEYMNCTWNSSSKPQPTNLTLHYWYENSDHDKVQECGHYLYSSEITSGCWLGKE
EIHLYHTFVVQLQDPQEPRRKTKKRLKLQDLVIPWAPENLTLHNLSESQLELRWSNRYLD
HCLEHLVQYRSDRDRSWTEQSVDHRRSFSLPSVDGQKLYTFRVRSRHNPLCGSAQHWSEW
SHPIYWGSHTLKEPPSLFALEAVLIPLGSIGLIISLICVYCWLERTMPRIPTLKSLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCHVSEIPTKGGALGEGPGGSPCSQHSPYWAP
PCYTLKPEP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagaaaccattgccactcagattcctcttattcctgcagctgcttctgctgggg
atagggctgacctcaacagtcctcacgtccaatgggaatgaagacatcacagctgatttc
ttcctgacctctacgcctcctgggaccctcaatgtttccaccttgcccctcccagaggtt
cagtgttttgtattcaatgtcgagtatatgaattgcacttggaacagcagctctaagcct
cagcccaccaacctgactctgcactattggtatgagaactctgaccatgacaaagtccag
gagtgtggccactatctatactcttcagagattacatctggctgttggttggggaaagag
gagatccatctctaccatacattcgttgtccagctccaggacccacaggaacctaggagg
aagaccaaaaagaggctaaaactgcaggatctggtgattccctgggctccagagaaccta
acccttcacaacctgagtgaatcccagctagaactgaggtggagcaacagatacttggac
cactgtttggagcatctggtgcagtaccggagtgaccgggaccgcagctggactgaacag
tcggtggaccacagacgtagtttctccctgcctagtgtggatgggcagaaactctacacg
tttcgtgttcggagtcgccataacccactctgtggaagtgctcagcattggagtgaatgg
agtcacccgatctactggggcagccatactttaaaggagcccccatcattgtttgctctg
gaagctgtgctcatcccccttggctccataggactgattattagcctcatctgtgtgtac
tgctggctggaacggaccatgcccagaattcctaccctcaagagcctagaggatctggtt
accgaataccacgggaacttttcggcttggagtggtgtgtctaagggactggcggagagc
ctgcagccagactacagcgaaaggctctgccacgtcagtgagattcccacaaaaggaggt
gctctaggggaggggcctgggggctccccctgcagccaacatagcccctactgggctccc
ccatgttataccctgaaacctgagccctga

KEGG   Miniopterus natalensis: 107533235
Entry
107533235         CDS       T05883                                 

Symbol
EPOR
Name
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107533235 (EPOR)
   04151 PI3K-Akt signaling pathway
    107533235 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107533235 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107533235 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533235 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107533235 (EPOR)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  Prolactin receptor family
   107533235 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 107533235
NCBI-ProteinID: XP_016063315
LinkDB
Position
Unknown
AA seq 507 aa
MGPLAAPLWPRVGSLWLLLTGAALAPPPNFPGPKFESKAALLAAHGPKELLCFTERLEDL
VCFWEEAASAGVSLHNYSFSYQLEGEQWKPCRLHQAPAARGAVRFWCSLPTADTSSFVPL
ELRVTAASSGAPRYSRVIQINEVVLLDPPAGLEARRADEGGHVVLRWLPPPGAPMASLIR
YEVNISAGSASGGTQKVEILDGRTECVLSNLRRGTRYTFKVRARMAEPSFDGFWSAWSEP
ASLLTASDLDPLILTLSLILVLILLLLAVLALLSHRRALKQKIWPGIPSPESEFEGLFTT
HKGNFQLWLYQNDGCLWWNPCTPFAEDTPIPLEVLSERCWGVTQAVEPGTDDEGPLLEPV
GSEHAQDTYLVLDKWLLPRSPPSEDSPRHGGDLDVAAMDEGSEASSCSSVLALKPEGASA
ASFEYTILDPSSQLLCPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGGSQGAKGGSS
NGSYSNPYENSLVPAPEPSPPSCVACS
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgggtcccctcgcggcgcccctctggcctagagtcggctccctctggcttctgctcact
ggggccgccttggctccccctcctaacttccctggccccaagtttgaaagcaaagcggcc
ctgctggcggcccacgggcccaaagagcttctgtgcttcaccgagcggttggaggacttg
gtgtgcttctgggaggaagcggcgagcgccggggtcagcctccacaactacagcttctcc
taccagctcgagggtgagcagtggaagccgtgccgcctgcaccaggcgcccgcggcccgc
ggagctgtgcgcttctggtgctcgctgcctacggcggacacgtcgagtttcgtaccctta
gaactgcgggtcacagcggcctcgtccggcgctccacgctacagccgagtcatccagatc
aacgaagtggtgctcctggacccccctgcggggctagaagcgcggcgggcggacgagggc
ggccacgtggtactacgatggctcccacctcctggggcccccatggcgagcctcatccgc
tacgaggtgaacatctccgcaggcagcgcctcagggggcacgcagaaggtggagatcctg
gacggccgcaccgagtgcgtgctgagcaacctgcggcgcgggacgcgctacaccttcaag
gtgcgcgcgcgtatggcggagccgagcttcgacggcttctggagtgcgtggtccgagccc
gcgtcgctgctcacagccagtgacctggacccgctcatcctgacgctctccctcatcctc
gtgctcatcctgctgctgctggccgtgctcgctctcctctcccaccgccgggctctgaag
cagaagatctggccaggcatcccaagccccgagagtgagtttgagggtcttttcaccacc
cacaaaggtaacttccagctgtggctgtatcaaaacgacggctgtctgtggtggaacccc
tgtacccccttcgcagaggacacacccatccccctggaagtcctctctgaacgctgttgg
ggggtgacacaagcagtggagccagggacagatgacgaggggcccctgctggagccagtg
ggcagtgagcatgcccaagacacctacctggtgctggacaaatggttgctgccccggagc
ccacccagcgaggactccccgcggcatggtggtgatttggacgtagcagccatggatgaa
ggctcagaagcatcctcgtgctcatctgttttggccctgaagccagagggggcttcagct
gccagctttgagtataccatcctggaccccagctcccagctcttgtgcccaagggcactg
ccccctgagctgccccccactccaccccaccttaagtacctgtacctcgtggtgtcagac
tctggaatctcaactgactacagctcagggggctcccagggagccaagggaggctcatcc
aatggctcctattccaacccctatgagaatagtcttgtcccagcccctgagccttcacct
cccagctgtgtggcctgctcctag

KEGG   Miniopterus natalensis: 107533449
Entry
107533449         CDS       T05883                                 

Symbol
IL12RB2
Name
(RefSeq) interleukin-12 receptor subunit beta-2
  KO
K05064  interleukin 12 receptor beta-2
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna05200  Pathways in cancer
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107533449 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107533449 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107533449 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533449 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107533449 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107533449 (IL12RB2)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107533449 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind Pur_ac_phosph_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 107533449
NCBI-ProteinID: XP_016063622
LinkDB
Position
Unknown
AA seq 860 aa
MALTVRACYLALIFVIMWLLVKAKIDVCKRGDVTVKPSHVISLGSAVNISCSLKPKQGCS
QYSSFNRLILYKSDRRIKLQDDHSLSTQVSGLPLGTTLFVCKLTCSSSEEIRICGAEISV
GVAPEQPQNLSCTQKGEHGTLACTWDRGQDTHLYTEYTLQLNGPKNLTWQKQCNDYYCDH
LDLGINLNPESPESSYTAKVTAINSLGSASSFPFTFTFLDIVKPLPPWDIGIQFVNDSVS
RCILQWRDEGMVLLNRLRYRPSNSRSWNMVNTTNAKGRHDLLDLKPFTEYEFQVSSKLHL
YKGSWSNWSESLRMQTPEEEPTGTLDVWYMKQNIDYNRQQISLFWKNLSVSEARGRILHY
QVTLMEATGKKVTLQNITEHTSWTWVIPRTGNWAVSVSAANSKGSSLPTHINITDLCGAR
LLAPRQVSASSEGVDVTVVWEPPGEPAPAVQEYVVEWRELRPARSALPPLNWLRAPPYNV
SAVISENIKPHMCYEIRVHALSGRQGGCSSIRANSGHKAPLSGPHINAITEEKGSIFISW
DEIPAQEQMGCILHYRIYWKERDSTAQPRLCEIPYRVSPNSHPIDSLQPRVRYLLWMTAL
TAAGESPQGKEREFCLQGKASWSTFVVPSICTAIIVVGVFSVRYFRQKVFVLLSALRPQW
CSREIPDPANSTWAKNYPTVEEKIQLPLDRLLTYWPTPKEPEPLVISEVLHQVTPVFTQL
LRSNWPEKGKGVQGHYTSEEDTGSSASSSPPPRALTAETGQLVDLYKVLGSRGPDSKPGN
PASLTVLPMDYLPTHEGYLPSNTDYLPSHEAPVTEPLEELEPQHISLSVFPSSSLHPLTF
SCGKKLTLDRLKMGCGSLML
NT seq 2583 nt   +upstreamnt  +downstreamnt
atggcactcacagttagagcatgctatttggcacttatttttgtcatcatgtggctgttg
gttaaagcaaaaatagatgtgtgcaaaagaggagatgtgaccgtgaaaccttcccatgtc
atctcacttggatcagctgtcaatatctcatgctctttgaagcccaagcaaggctgctct
cagtattccagctttaataggttaatcctctacaagtctgacagaagaatcaagctacag
gatgatcactccctcagtactcaggtctcaggtctgcctctgggtacaacactgtttgtc
tgcaaattgacctgtagcagtagtgaggagatccgaatatgtggggcagagatctcagtt
ggtgttgctccagaacagcctcaaaacttatcttgtacacaaaagggagaacatgggacc
ttggcctgcacctgggacagaggacaagacacccacctatatactgagtatactttacag
ttaaatggaccaaaaaatttaacatggcagaaacaatgtaatgattattattgtgaccat
ttggaccttggaatcaacctaaaccctgaatcacctgaatccagttacacagccaaggtt
actgctatcaatagtcttggaagtgcttcttcatttccattcacattcacattcttggac
atagtgaagcctcttcctccgtgggacatcggaatccaatttgtaaatgattctgtgagc
agatgcattcttcagtggagagatgaggggatggtgctgcttaatcgactcagatatcgg
cccagtaacagcaggtcctggaatatggttaatactacaaatgccaaaggaagacatgat
ttgttggatctgaaaccatttacagaatatgaatttcaggtttcctctaagctacatctt
tataaaggtagttggagtaattggagtgaatcattgagaatgcaaacaccagaagaagag
cctactgggacattagatgtctggtacatgaagcagaacattgactacaatagacaacag
atttctcttttctggaagaatctgagtgtatcagaggcaagaggaagaatccttcactat
caggtgactttgatggaagcaacagggaagaaagtcacgctacagaacatcacagaacat
acctcctggacctgggtcattcccagaactgggaactgggctgtgtctgtgtctgccgct
aactcaaaaggcagttccctgcccactcatattaacataacggacctgtgtggggcaagg
ttgctggctccccgccaggtctctgcaagctccgagggcgtggacgttacggtggtgtgg
gagccccccggggagcctgccccagctgtccaagagtacgtggtggagtggagggagctc
cggccggcgcgcagcgcgctgcccccgctgaactggctccgggctcccccctacaacgtg
tccgctgtgatttcagagaacataaaacctcacatgtgttatgaaatccgcgtgcacgcg
ctgtcagggcgccaggggggatgcagctccatccgcgctaactctgggcacaaagcacca
ctgagtggcccccacattaatgccatcacagaggaaaaggggagcattttcatttcatgg
gacgaaattccagcccaggaacaaatgggctgcatcttgcactacaggatatactggaag
gaacgggactccactgcccagcctcgactctgtgaaattccctatcgggtctctccaaat
tcacatccaatagacagcctgcagcccagagtgagatacctcctgtggatgacagctctg
acagcagctggtgaaagcccccaaggaaaggagagggaattttgtctgcaaggtaaagcc
agttggagcacatttgtggtaccgagcatttgcactgctatcatcgtggtgggcgttttc
tcagtgcgctacttccggcaaaaggtatttgttctcctttcagccctcagacctcagtgg
tgtagcagagaaattccggacccagcgaacagcacttgggccaagaactatcccactgtg
gaggagaagatccagctgcccttggacaggctcctgacatactggcccactccgaaagaa
cccgagcccctggtcatcagcgaagtccttcatcaagtgacccccgtcttcacacagctc
cttcgttccaactggccagaaaagggaaaaggagtccaaggtcactatacctctgaggaa
gacacagggtccagtgcctcaagctcaccacctcccagagctctcacagcagagacagga
cagcttgtggatctgtacaaggtgctggggagcaggggacctgactcaaagccaggaaac
ccagcaagcctgacagtcctcccaatggactatcttcccactcatgagggctacttaccc
tccaacacagactatctcccttcacacgaggctcctgtaactgagcccctggaagaactg
gagcctcagcacatctctctttctgttttcccctcaagttcccttcacccgctcaccttc
tcctgtggtaagaagctgactttggatcggttaaagatggggtgtggctctctcatgctt
tga

KEGG   Miniopterus natalensis: 107533557
Entry
107533557         CDS       T05883                                 

Symbol
LEPR
Name
(RefSeq) leptin receptor isoform X1
  KO
K05062  leptin receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04080  Neuroactive ligand-receptor interaction
mna04152  AMPK signaling pathway
mna04630  JAK-STAT signaling pathway
mna04920  Adipocytokine signaling pathway
mna04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107533557 (LEPR)
   04152 AMPK signaling pathway
    107533557 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107533557 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    107533557 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107533557 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107533557 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107533557 (LEPR)
   04090 CD molecules [BR:mna04090]
    107533557 (LEPR)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  Prolactin receptor family
   107533557 (LEPR)
CD molecules [BR:mna04090]
 Proteins
  107533557 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 107533557
NCBI-ProteinID: XP_016063781
LinkDB
Position
Unknown
AA seq 895 aa
MTCQKLCLALLHWEFIYVITAFNLAYPINPWGFKLFCIPPNTTYDFLLSAGISKNASILN
GYYETLSEAKFNSSGTYYSNLTSKTTFQCCVWNGEDKHCSGHADDIERKALVSTVNPLVF
QQIGANWNIQCWMKEDLKLFICYIEPLFKNPFKNYELKVHLLYALPEVLEESPAVPPKGS
FQLVRCNCSVPECCECPVSVPAARLNCTLFMYLKITSAGVVFQSPLMSVQPITIMKPDPP
LGLHMEITDSGNLKISWLSSTLVPFQRQYQVKYSENSTSVREADEIVSATSLLVDSVLPG
SSYEVHVRGKRLDGPGIWSDWSSPLIFTTQDVIYFPPKILTSVGSNVSFHCIYKNENKIV
PSEKIVWWMNLAEKIPESQYNVVGDRVSKVSLPNLNATRPRGKFTYDAVYCCEEHECHHR
YAELYVIDVNINILCETDGYLTKMTCRWSTNAIQSLVGSTLQLRYHRSSLYCSDVPSIHP
TSEPKDCHLQRGGFYECVFQPIFLLSGYTMWLRISHSLGSLDSPPTCVVPDSVVKPLPPS
SVKAEITSKIGLLKISWKKPIFPENNLQFQIRYGLNGKEVQWKMHEVSDAKSKSVSLPVP
DLCAVYAAQVRCRRLDGLGYWSNWSTPAYTVVMDIKVPIRGPEFWRIINEDITKKERNVT
LLWKPLMKNDSLCSVRTYVVKHHTSRSGTWSEDVGNHTRFTFQWTEQTHTVTVLAVNSVG
ASFANFNLTFSWPMSKVNIVQSLSAYPLNSSCVILSWMLSLTDYKLMYFILEWKILNEDN
EIKWRKIPSSVKRYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFLQDDIEKHQTDAG
LYVIVPIIISSLTLLLGALLILHQRMKKLFWDDVPNPKNCSWAQGLNFQKNTDIL
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgacttgtcaaaaactttgtttggctttgttacattgggaatttatatatgtgataacg
gcgtttaacttggcatatcccattaatccttggggatttaagttgttttgcataccacca
aatacaacctatgactttctcctgtctgctggaatctcaaagaacgcttcaattttgaat
ggatattatgagacactttctgaagctaaatttaattcaagtggtacatactattctaac
ttaacatccaaaacaactttccagtgttgtgtttggaatggggaagataagcactgctct
ggacatgcagatgacattgaaaggaaggcattggtttcaacagtaaatcctttagttttt
caacaaataggtgcaaactggaacatacagtgctggatgaaagaggacttgaaattattc
atctgttatatagagccattatttaagaatcctttcaagaattacgagcttaaggtccat
cttttatatgccctgccagaagtgttggaagaatcaccggcggtccccccgaaaggcagt
tttcagcttgtgcggtgcaactgcagtgttcctgagtgttgtgaatgccccgtgtctgtg
ccagcggccagactcaactgcacgctctttatgtatttaaaaatcacatccgctggagtg
gtatttcagtcacctctaatgtcggttcaacccataactatcatgaagccggatccacca
ttaggtttgcatatggaaatcacagacagtggtaatttaaagatttcttggctcagttca
acactggtaccatttcaacgtcaatatcaagtgaaatattcagagaattctacaagtgtg
agagaagctgatgagattgtctcagccacatctctgctagtagacagtgtgcttcctggg
tcttcgtatgaggttcacgtgaggggcaagagactggatggccctggaatctggagtgac
tggagctcccctctcatttttaccacacaagatgtcatatactttccccctaaaattctg
acaagtgttggctctaatgtttcttttcactgcatctacaaaaatgaaaacaagattgtt
ccctcagaaaagattgtttggtggatgaatttagctgagaaaattccggaaagccagtat
aatgttgtgggggaccgcgtcagcaaagtcagccttcccaacctgaacgcaaccaggcct
cgggggaagttcacctacgatgcagtgtactgctgcgaggagcacgagtgccaccaccgc
tacgcagagctgtatgtgatcgatgtcaatatcaatatattgtgtgagactgatgggtac
ttaactaaaatgacttgcagatggtcaactaatgcaatccaatcactcgtggggagtact
ttgcaattgagatatcacaggagcagcctttattgttctgatgttccatctattcatccc
acatctgaacccaaagattgccatttgcagagaggtggtttttatgaatgtgtgtttcag
ccaatctttctgttatccggttacacaatgtggttaaggatcagtcactcgctgggttcc
cttgattcgcctccgacatgtgtcgttcctgattctgtggtgaaaccattgcctccatcc
agtgtgaaagcagaaattacttcaaaaattggattattgaaaatatcttggaaaaagcca
atttttccagagaataatcttcagttccagattcgctatggtttaaatgggaaagaagta
caatggaagatgcatgaggtatctgatgcaaaatcaaaatccgtcagcctcccggtgcca
gacctgtgtgctgtctacgccgcgcaggtgcgctgcaggaggctggatggactggggtat
tggagtaattggagcactccggcctacacagttgtcatggatataaaagttcctatcaga
ggacctgaattttggagaataattaatgaagacatcactaaaaaagagagaaatgtcact
ttactttggaaacccctgatgaaaaatgactcattgtgcagtgtgagaacatatgtggta
aaacatcacacttcccgcagtggaacatggtcagaagatgtgggcaatcacaccagattc
actttccagtggacagaacaaacacacactgttacagttctggctgtcaattcagttggt
gcctcttttgcaaattttaatttaacattctcatggcctatgagcaaagtaaatatcgtg
cagtcactcagtgcttatcctttaaacagcagttgtgtgattctttcttggatgctctca
cttactgattacaagctgatgtattttattcttgagtggaaaattcttaatgaagacaat
gaaattaaatggcgcaagatcccttcatctgttaagaggtattatatccatgatcatttt
atccctattgagaaatatcaattcagtctttacccaatatttatggaaggagtggggaag
ccaaagataattaatagttttttgcaagatgatattgaaaaacaccagactgatgcaggt
ctatatgtaattgtgccaataattatatcctcattaaccttgctgcttggagcattgcta
atattacatcaaagaatgaagaagctgttttgggatgatgttccaaaccccaagaattgt
tcctgggcacaaggactgaattttcaaaagaatacggacattctttga

KEGG   Miniopterus natalensis: 107533896
Entry
107533896         CDS       T05883                                 

Symbol
IL23R
Name
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04659  Th17 cell differentiation
mna05200  Pathways in cancer
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107533896 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107533896 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107533896 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533896 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107533896 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107533896 (IL23R)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107533896 (IL23R)
SSDB
Motif
Pfam: fn3 IL6Ra-bind IL12p40_C PriX Pur_ac_phosph_N Lep_receptor_Ig
Other DBs
NCBI-GeneID: 107533896
NCBI-ProteinID: XP_016064262
LinkDB
Position
Unknown
AA seq 631 aa
MNQAMVQWDVVIVLYTLLSWCHGGITSINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKFYFYKNFIKERFKITRINTTTAQLQYNNFLEPRASMHCTAECPGYSKETLICGKDIS
SGYPPDVPDKVTCVIYEYSGNMTCTWNTGKPTYIDTKYVVHVKSLETEEEQQYLTSNYVN
ISTDSLRGGKKYLVWVHAANVLGMEKSKQLQVDLDDIVIPSAAIISRAEDINTTAPKTVI
YWNSQTAIEKVSCEMRYKATANRTWNVKEFDTNFTYVQQSTFYLEPNTKYVFQVRCQETG
KSYWQSWSSPFFHKTPETVPLVTLKSFQHDTRNSGLLMVSILKRHLTSDNRQPDIGLLSG
MVSFAVVLSILSLIGIFNKSLRAGIKRRILLLIPKWLHEDIPRIKNSNAVKMLQEKSELM
NNNSTEQVLYVDPVITEIEIFFQEEHKPTDYRKEKNTGSLETTDCLQKSLLTNTTVVYIP
DLNTGYKPQISNFLNEENHLSNDDETTSSTLKPTVDFLDLGKDAQFKKYPNFALSVSSIN
SPSNTLFLEELSLILNQGDCSPSDMQNSIEGETTMLLENASPSETIPEQTLLPDEFVSCL
GIVNEELPSINSYFPQNILESHFNRISLLKK
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaatcaggccatggttcaatgggacgtggtgatagtgctttacacactcctcagctgg
tgccatggaggaattacaagtataaactgctctggccacatctgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaaggaaattttatttttataaaaatttcatcaaagaaagatttaaaatcacaaggatt
aatacaacaacagctcagcttcaatataataactttctggaaccacgtgcctctatgcac
tgcaccgctgaatgtcctggatattctaaagagacactgatatgtggaaaagacatttct
tctggatatccaccagatgtccctgacaaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgtacctggaatactgggaagcccacctacatagacacaaagtatgtggtg
cacgtgaagagtttagagacagaagaagaacaacaatatctcacctcaaattatgttaac
atctccactgactcattacgaggaggtaagaagtatttggtttgggtccacgctgcaaat
gtactgggcatggagaagtcaaaacaactgcaagttgacctggatgatatagtgatacct
tctgcagccatcatttccagggcggaggatatcaatactacagcccccaagactgtgatt
tattggaacagtcaaacagcaattgaaaaggtttcctgtgaaatgagatacaaggctaca
gcaaaccgaacttggaatgttaaggaatttgacaccaattttacatatgtgcaacagtca
actttctatttggagccaaacactaaatatgtatttcaagtgagatgtcaagaaacaggt
aaaagctactggcagtcctggagttcacccttttttcataaaacacctgaaacagttcct
ctggtcacactgaaatcattccaacacgatactcggaattctgggcttctaatggtttcc
atccttaaaagacaccttacttctgacaacaggcaaccagacattggacttttatcggga
atggtctcctttgctgttgtgttgtcaattctttctttgattggaatatttaacaaatcg
ctccgagctggaattaaaagaagaatcttactgctaataccaaaatggcttcatgaagac
attcctaggataaaaaacagtaatgctgtgaaaatgctacaggaaaagagtgaacttatg
aataataattccactgaacaggtcctatatgtcgatccagtgattacagagatagaaatc
tttttccaagaagaacacaagcccacggactacaggaaggaaaagaatacaggttccctg
gagacaacagactgcctgcaaaagtcactgctcaccaatactacagttgtatatattcct
gatctcaacaccgggtataaaccccagatttcaaactttctcaacgaggaaaaccatctc
agcaatgatgatgaaacaacttcgtcaactctcaaaccaacagttgatttcttagacctg
gggaaagatgcccagtttaaaaaatatcctaattttgctctttctgtctcaagtataaac
tcgccaagcaatacactctttcttgaagaattaagcctcattttaaatcaaggagattgc
agtccttctgacatgcaaaactcgatagagggtgaaaccaccatgcttttggaaaatgcg
tcacccagtgaaactattccagaacagaccttgctgcctgatgaattcgtctcctgtttg
gggatcgtgaatgaggagttgccatctattaattcttatttcccacaaaatattttggaa
agccacttcaataggatttcactcttgaaaaagtag

KEGG   Miniopterus natalensis: 107535230
Entry
107535230         CDS       T05883                                 

Symbol
PDGFRB
Name
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107535230 (PDGFRB)
   04014 Ras signaling pathway
    107535230 (PDGFRB)
   04015 Rap1 signaling pathway
    107535230 (PDGFRB)
   04630 JAK-STAT signaling pathway
    107535230 (PDGFRB)
   04020 Calcium signaling pathway
    107535230 (PDGFRB)
   04072 Phospholipase D signaling pathway
    107535230 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    107535230 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107535230 (PDGFRB)
   04540 Gap junction
    107535230 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107535230 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535230 (PDGFRB)
   05206 MicroRNAs in cancer
    107535230 (PDGFRB)
   05230 Central carbon metabolism in cancer
    107535230 (PDGFRB)
   05231 Choline metabolism in cancer
    107535230 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    107535230 (PDGFRB)
   05218 Melanoma
    107535230 (PDGFRB)
   05215 Prostate cancer
    107535230 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107535230 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107535230 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107535230 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107535230 (PDGFRB)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107535230 (PDGFRB)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107535230 (PDGFRB)
CD molecules [BR:mna04090]
 Proteins
  107535230 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6 TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 107535230
NCBI-ProteinID: XP_016066086
LinkDB
Position
Unknown
AA seq 1126 aa
MFGLGTCRFQGLCICVSFEERCGGSWALTSGASSPQGQALLLPLLLLLGPQTSQGLVITP
PGPELVLNVSSTLVLTCSGPEPVVWKRMSKKLTQEMVKTEDGNFSSILTLTDVTGIDTGE
YFCTYNNSNEVEAGEQKRLYIFVPDPTMGFLPIFPEEFFIFLTEVTETTIPCRVTDPQLV
VTLHEKKVDDPLPIPYDHQRGFSGTFEDKTYVCKTTIGDKEVDSEPYYVYSLQASSINVS
MNAAQTVVRQGENITITCIVTGNEVVNFEWTYPREESGRLVEPVTDFDIPHIRSTLHIPS
AELGDSGTYICNVSESLYDHQDEKAINVTVVESGYVHLLSELDAVQFAELHRSRTLQVVF
EAYPLPTVLWFKDNRTLGDSNAGEIALSTRNVSETRYVSELTLVRVKVDEAGRYTMLAFH
EDAEAQVSFQLQINVPVRVLELSESHPANGEQTVRCRGRGMPQPHITWSTCSDLKRCPRE
LPPTPLGNSSEEEGQLETNVTYWAEEQEFEVVSILRLRRVDQPLSVRCTLRNLLGDDVQE
VILVPQSLPFKVVVISAILALVVLTIISFIILIMLWQKKPRYEIRWKVIESVSSDGHEYI
YVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTA
RSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTF
LQHCSDKRRRASAELYSNALPVGLPLPSHMSLPGESDGGYMDMSKDESVDYVPMLDMKGD
IKYADIEPSNYMAPYDNYVPSAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASK
NCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLY
TTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKC
WEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAVLRSQARFPGFHGLRS
PLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISC
DSPLELQEEPEPEPQPESRVELEAEPEWLPESSCPEPRAEAEDSFL
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgtttggattagggacatgtcgttttcaagggctgtgcatatgtgtcagctttgaggag
aggtgtggaggctcctgggctctgacatctggtgcctcctctccccaaggccaggcgctc
ttgctgcccctgctgttgttgctaggaccacagacatcccaaggtctggtcatcacacct
ccggggccagagcttgtcctcaatgtctccagcaccttggttctgacctgctcgggtcca
gagcctgtggtgtggaaacggatgtccaagaagctcacgcaagaaatggtcaagaccgag
gatggcaatttctccagcatcctgacgctgactgatgtcactgggatagacacaggagaa
tacttttgtacctacaataactccaatgaggtggaggctggtgagcaaaaacggctctac
atctttgtgccagaccccaccatgggcttcctcccgatcttccccgaggaattcttcatc
tttctcacggaagtaactgagaccacaattccatgccgcgtgacggatccccaactggtg
gtgacactgcatgagaagaaagtggacgatccacttcccatcccctatgaccaccaacgt
ggcttctctgggacctttgaggacaagacctatgtctgcaaaacgaccatcggggacaag
gaggtggattctgagccctactatgtctacagcctccaggcgtcatccatcaatgtctca
atgaatgcagcgcagactgtggttcgccagggcgagaacatcaccatcacgtgcatcgtc
actggcaacgaggtggtcaactttgagtggacgtacccccgcgaggagagtgggcggctg
gtggagccagtgaccgactttgatattccccacatacgttccaccctgcacatccccagt
gctgagctgggcgactcagggacctacatctgcaatgtgtccgagagtttgtacgaccat
caagatgaaaaggccatcaatgtcaccgtggttgagagtggctacgtgcacttgctgagt
gagctggacgctgtacagttcgcggaactgcaccggagccggactctgcaggtggtgttc
gaggcctacccgctgcccactgtcctgtggttcaaggacaaccgcaccctgggcgactcc
aacgccggcgagatcgccctgtccacgcgcaatgtgtccgagactcggtatgtgtcagaa
ctgacactggtgcgagtgaaggtggatgaggctggtcgctacaccatgttggccttccac
gaggatgcggaggcccaggtctccttccagctgcaaatcaatgtgcctgtccgggtgctg
gagctgagtgagagccaccctgccaatggggagcagacagtccgctgtcgtggccggggc
atgcctcagccacacatcacctggtctacctgcagtgaccttaaaaggtgtccgcgcgag
ctgccgcccacgcctctggggaacagctcggaggaggagggccagctggagaccaacgtg
acgtactgggcggaggagcaggagttcgaggtggtgagcatcctgcgcctgcgccgagtg
gatcagccgctgtcggtgcgctgcacgctgcgaaacctgctgggcgacgacgtgcaggag
gtcatcctggtgccccagtccttgcccttcaaggtggtggtgatctcggccatcctggcc
ttggttgtcctaacgatcatctccttcatcatcctcatcatgctctggcagaagaagccc
cgctatgagatccgatggaaggtgattgaatctgtgagttccgacggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacctgggagctgccgcgggaccagctt
gtgcttggacgtaccctgggctccggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggctacaatgaaagtggctgtcaagatgctaaaatccacagcc
cgcagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcacctcgggccc
cacctgaatgtggtcaatctgctgggagcctgcaccaaaggagggcccatctacatcatc
actgagtactgccgctacggcgacctggtggactacctacaccgcaacaagcacaccttc
ctgcagcactgctccgacaagcgccgccgggccagcgccgagctctacagcaacgccctg
ccggtcgggctccccctccccagccacatgtccctgcctggggagagtgacggtggctac
atggacatgagcaaggacgagtcggtggactatgtgcccatgctggacatgaaaggagac
atcaaatatgcagacattgagccctccaactacatggctccctatgataactacgtcccc
tccgctcccgaaaggacctgccgagcaactttgattaacgagtccccagtgcttagctac
atggatcttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaag
aattgtgtccaccgagacctggcagccagaaatgtgctcatctgtgagggcaagctggtc
aagatctgtgactttggccttgctcgtgacatcatgcgggactctaactacatctccaaa
ggcagtaccttcctgccgctgaaatggatggcccccgagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtcctttgggatcctactctgggagatctttaccctgggt
ggcaccccttacccagagctgcccatgaacgagcagttttacaatgccatcaagcggggt
taccgcatggcccagcctgcccacgcctccgacgagatttacgagatcatgcagaagtgt
tgggaagagaagtttgagatccgcccccccttttcccagctggtgctgcttctcgagaga
ctgctgggcgagggttacaaaaagaagtaccagcaggtggatgaggagttcctgaggagc
gaccaccccgctgtccttcggtcccaagcccgcttcccaggcttccatgggctccgatcc
cccctggacaccagctcagtcctctacactgctgtgcagcccaacgagggtgacaatgac
tatatcatccccctgcccgaccctaaacccgaggttgctgatgagggcccactggagggc
tcccccagccttgccagctctacgctgaatgaagtcaacacctcctctaccatctcctgt
gacagccccctggaactacaagaggaaccagagccagagccccagcctgagtcccgggtg
gagctggaggcagaaccagagtggctgccggagtcaagctgtcctgagccccgggctgag
gcagaggacagcttcctgtag

KEGG   Miniopterus natalensis: 107535370
Entry
107535370         CDS       T05883                                 

Symbol
IL12RB1
Name
(RefSeq) interleukin-12 receptor subunit beta-1
  KO
K05063  interleukin 12 receptor beta-1
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna05200  Pathways in cancer
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107535370 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107535370 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107535370 (IL12RB1)
   04659 Th17 cell differentiation
    107535370 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535370 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107535370 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107535370 (IL12RB1)
   04090 CD molecules [BR:mna04090]
    107535370 (IL12RB1)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107535370 (IL12RB1)
CD molecules [BR:mna04090]
 Proteins
  107535370 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind
Other DBs
NCBI-GeneID: 107535370
NCBI-ProteinID: XP_016066292
LinkDB
Position
Unknown
AA seq 722 aa
MGQRVARLVPLLLFLLPGQCAEACGISRCCFQDPPYRNADSGSASGPRDLNCYRIFGARY
ECSWEYEGPAAGVSHFLRCCLGSRHCCYFSAGTATKLQFSEQDGVSVLDNVTLWVESWAA
NWTEKSPKVTLNLYSSVKYDPPPEDIKVSRLAGQLCMEWETPARQESAEVQFRHRTPDRP
WKLGDCANQDASGFESCFCPLETNEAQEFQLRRRQLGPGALRGPWSSWSSSVCVPPDPPP
LPEVLFLVEPLGLDGRRQVTLQRQLFQLQLPEGCHGSKSGAEVTYHLHLHMLSCTCKAKA
TRTLSLRKALHLSGAAYDLAVVSRNRFGPGPNQSWHIPAHTHAEPGALNISAGANGTTMS
WRAWAPGLTYCIEWQPQGQDKSPANCTLTAPKDPDSAGTVTHHWSQASGAMGQKMCYHIT
IFSSAQPKKPTSWSTVLSTYYFGGNASEAGSPQHISVKMLSPNSVTVDWMPSLLSTCPGV
LKKYIVRYQDEDSNQVSELPVNPTETQVTLGGLRAGTAYSVRVRADTATLRGTWSQPQGF
RMEVQLSEAESPDLSSIPVILASLGSFLSILLLGVLGYFSLNRALPHLCPPLPTPCASTA
VEFPSSQGKQAWQWVSPGDFPVEEEESLKEALVVTMPFEKGEVADLDTPSPLKDKIELPQ
GTLESALDTELPLEDRRQVQGHLETRVLGPSGKNSLEGSPAQETGLSLLLGDHMQSPRAN
GP
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggggcagcgagtggccaggctggtcccgctcctcctcttcctgctccccggacaatgt
gcagaagcctgtggtatcagcaggtgctgttttcaggacccaccatatcggaatgcagat
tcaggctcagcttcaggtcccagagacctgaactgctaccggatatttggtgcccgttat
gaatgctcctgggagtatgagggccccgcagctggagtcagccatttcctgaggtgctgc
ctcgggtccaggcactgctgctacttctctgcaggcacagccaccaagctgcagttctct
gaacaggatggtgtatctgtgctggacaatgtcactctctgggtggaatcctgggccgcc
aactggacagagaagtcgcccaaggttaccctgaatctatacagctctgttaaatacgac
cctccgccagaagacatcaaagtgtcacggttagcagggcagctgtgcatggagtgggag
accccagcccgccaggagagcgctgaggtgcagtttcggcaccggacacctgaccgtcca
tggaagttgggtgactgtgcaaatcaggatgcttctggctttgagtcgtgcttctgcccg
ctggagacaaacgaagcccaggaattccagctaaggcggcggcagcttgggccaggggcc
ctgagaggtccctggagcagctggagcagctctgtgtgtgtcccccctgacccgccccca
ctgccggaggtgctgttcttggtggagccgcttggcctggatgggaggaggcaagtgacc
ctgcagaggcagctgttccagctccagctcccagaaggctgccatgggtccaagtctggc
gcagaggtgacctaccacctccacctgcacatgctgtcctgtacgtgcaaggccaaggca
acgaggaccctgagtctgagaaaagcactccacctctcgggtgctgcctatgacctggct
gttgtctccaggaatcgctttggccccggccccaaccagtcgtggcacattcctgcccac
acgcacgcagaaccaggagctctgaatatcagtgctggagccaatgggaccactatgagt
tggcgggcctgggctccaggcctgacgtactgcattgagtggcagccccagggccaggac
aagagccccgccaactgcaccctcactgcgcccaaagacccagattctgctggaactgta
acccaccactggagccaagcttccggggcaatggggcagaagatgtgttaccacatcacc
atcttttcctctgcacaaccgaagaagcccacctcatggtccacagtcttatccacctac
tactttgggggcaacgcctcagaggctgggagcccacagcacatttcagtgaagatgctc
agcccaaactcggtgactgtggactggatgccatctctgctgagcacctgccctggcgtc
ctaaagaagtacattgtacgctaccaggacgaagacagcaaccaggtgtctgagctgccc
gtgaaccccacagagacccaggtcacccttggtggtctgagggctggcacagcctacagc
gtgcgggtgcgagcggacaccgcgacactgaggggcacctggagccagccccagggcttc
cgaatggaagtgcagctttcggaggcggagtcgcctgatttgtcctccatccccgtcatc
ctcgcgtctctggggagcttcctgagcattctcctcctgggtgtccttgggtacttcagc
ctgaacagggccttgccgcacctgtgcccgcccctgcccacaccctgtgccagcactgct
gttgagtttcctagcagccaggggaagcaggcttggcagtgggtcagcccaggagacttt
ccggtggaggaggaagagtccctgaaagaggccctggtggtgaccatgccctttgaaaaa
ggcgaagtggctgacctggacacacccagccctctcaaggacaagatagagctgcctcag
ggcacccttgagtcagccctagacacagagctgcccttggaggacaggagacaggtgcaa
ggacaccttgagaccagggtgctggggcccagtgggaagaacagtctggagggcagtcct
gcccaggaaactggactgtccctgctcctgggagatcacatgcagagtcctagggccaat
ggtccttga

KEGG   Miniopterus natalensis: 107537453
Entry
107537453         CDS       T05883                                 

Symbol
IFNGR2
Name
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04066  HIF-1 signaling pathway
mna04217  Necroptosis
mna04380  Osteoclast differentiation
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05164  Influenza A
mna05168  Herpes simplex virus 1 infection
mna05200  Pathways in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107537453 (IFNGR2)
   04066 HIF-1 signaling pathway
    107537453 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107537453 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107537453 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107537453 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    107537453 (IFNGR2)
   04659 Th17 cell differentiation
    107537453 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107537453 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537453 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107537453 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    107537453 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    107537453 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107537453 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107537453 (IFNGR2)
   05140 Leishmaniasis
    107537453 (IFNGR2)
   05142 Chagas disease
    107537453 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107537453 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107537453 (IFNGR2)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IFN receptor family
   107537453 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 HRG
Other DBs
NCBI-GeneID: 107537453
NCBI-ProteinID: XP_016068965
LinkDB
Position
Unknown
AA seq 354 aa
MGHSAGRLVTVAGELNAHLARESGKLQQRSLGPAAVPATRVPADPPSQLPAPQNPTIHLY
NAKQALSWEPVSLSNETGPVVYRVQFKFFHSSPESKWSDIDGSPTKPVEVNCSKITKTEC
NFTPTSRSKGFLPYFNISLRVRAELQDRTSPWALVPWFQHYRNVTIGPPENIWVTPEEGS
LIIQLSAPFDVLSSEATFLYYVYYWEKAGEQQVRGPFRSNFIVLKDLKPLKVYCLQVQAQ
LSWTLLPVLRSGHLSNISCHETTADASTKPQQAVLIAVGTFLSLVGLAGACFFLILKYRV
LIKHWFHSPPGIPVQIEEYLKDPAQPILEALDSDSSPKEDVWDSVSVISLPQKE
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggggcattctgcgggaaggctcgtgaccgtggctggggagctaaacgcgcacctggcc
cgggagtcagggaagctgcagcagaggagccttgggccggctgcagtccctgccacccgg
gtgccagcagaccctccttcccagctgcctgctcctcagaacccgacgattcacctgtac
aacgccaagcaggctctgagctgggagccggtgtccctgagcaacgagacagggccagtg
gtgtaccgggtgcaattcaaattctttcattctagccccgaaagcaagtggtctgacatc
gatgggagtcccaccaagcccgtcgaggtgaactgttcgaagatcaccaagacagagtgt
aacttcaccccgaccagccgctccaagggcttcctgccctatttcaacatctctctacgt
gtgcgagccgagctgcaggaccgcacctccccctgggccctggtgccttggttccagcac
tatcggaacgtgaccatcgggcctccagaaaacatctgggtgacgccagaggaaggctcc
ttgatcatccagttgtccgctccctttgacgtcctgtcctccgaggccacgtttttgtat
tatgtctattactgggaaaaggcaggggagcaacaggtcagaggtcccttcaggagcaac
ttcattgtgttgaaggatctgaagcccctgaaagtgtactgtttacaagtccaggcacag
ctgtcctggacgttattaccggtccttagatccgggcatttaagcaacatttcttgtcac
gaaacaacagcagatgcctccaccaagccccagcaagcggtcctgatcgccgtggggacc
ttcctgtcgctggtggggctggcaggggcctgtttcttcctgatcctgaagtacagagtc
ctgatcaagcactggttccactccccgccgggcatcccggtgcagatagaggagtattta
aaggacccggctcagcccatcctggaggccctggacagtgacagctcgcctaaggaggat
gtctgggactctgtgtctgtcatctcgttgccacagaaggagtag

KEGG   Miniopterus natalensis: 107537472
Entry
107537472         CDS       T05883                                 

Name
(RefSeq) interleukin-10 receptor subunit beta-like isoform X1
  KO
K05135  interleukin 10 receptor beta
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04630  JAK-STAT signaling pathway
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107537472
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107537472
   04061 Viral protein interaction with cytokine and cytokine receptor
    107537472
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107537472
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107537472
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107537472
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107537472
   04090 CD molecules [BR:mna04090]
    107537472
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL10/28 receptor family
   107537472
CD molecules [BR:mna04090]
 Proteins
  107537472
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 107537472
NCBI-ProteinID: XP_016068992
LinkDB
Position
Unknown
AA seq 583 aa
MLWDYHAYAVGLLNLYLLVHIGPVVGALEALSEFPEESCIFNITLRNFRPILSWELRNHS
IVPTHYTLWYTCMSKEKEMKIVEECTNITRTFCDLTNRWGSSAEMYFTRLEGFRGSTKLV
SCLSSVFPDVHMSLEPPEFEIVGFVEHVNVILRFPPALPTLPDGEGMWSNLLLIIEEESE
GIVKQHKLRINQNTTGNFIYTIDKLIPNTNYCVSVYFEPKDLQTIKRSPLKCTFLQPGQE
SALGMVPPPENVRMNSVNFKNILEWESPAFPKGNLTFTAQYLSYRKFQDTCTSTPATECD
FSSLSKYGDHTLRVRAELGDEHSAWVNLTFCPVDDTVIGPPGLQVEALANSLHIRFLAPR
IEKEHETWTMKNIYNSWVYNVQYWKNGSDEKYPVTCQYDFEVLRNLEPWTTYCVQVQGFL
PDRNKTGEWSEPVCEQTISDESAPVWIVVTVVLAASVCACLLLMGCFLLLWYIYKRTKYA
FYPGNTLPQHLKEFLSHPHHNRLLFFSSPLSDENEVFDKLSVVTEASESNKQNPGDGCSL
GAPPGGGAGPPGVLQGGGTPHFPLLPLRVSNKRGPRPPEQAPV
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgctttgggactaccatgcctacgcggttggactccttaatttgtatctcctggtgcac
atcgggcccgtggtcggtgctttggaagctttgtctgagtttccagaagagtcgtgcatt
ttcaacataaccctaagaaatttccggccaatcttatcatgggaattaagaaaccattcc
atcgtaccaactcactacacgttatggtacacgtgcatgagtaaagaaaaagagatgaag
atcgtcgaggagtgcaccaacatcacgagaacattctgtgacctcacgaacaggtggggc
agctctgccgagatgtacttcaccaggctggagggcttccgagggagcacaaagctggtc
agctgtttgagctcggtcttcccagatgtgcacatgtctttggagccccccgagtttgag
atcgttggctttgtggagcacgtcaatgtgatcctgaggttcccacccgccttgcccacg
ttgccagatggggaaggcatgtggtctaacctgctgctgatcattgaagaggagtcggag
gggattgtgaagcagcataaactcagaataaatcaaaacaccactgggaattttatttac
accatcgacaagttaatcccaaacacaaactactgtgtatctgtttattttgagcctaag
gacctgcaaacaataaagagatctcctttgaaatgtacctttcttcagcctggacaagaa
tcagcattaggaatggtgcctcctcctgaaaacgtcagaatgaattcagttaatttcaag
aacattctagagtgggagtcacctgcttttcccaaagggaatctgactttcacagctcag
tacctaagttacaggaagttccaggacacgtgcaccagcacccccgcaacggagtgcgac
ttctccagcctttccaagtacggggaccacaccttgcgagtcagggctgaacttggagac
gagcactcagcctgggtgaacctcaccttctgtcccgtcgatgacaccgttattggacct
cctggattgcaagtagaagcgcttgctaattctttgcacatacgtttcttggccccgaga
attgagaaggaacatgagacatggaccatgaagaatatctataactcatgggtttataat
gtgcagtattggaagaatggctctgatgaaaagtatccagtgacttgtcagtatgacttc
gaggtcctcagaaacctggagccgtggacaacttactgtgttcaagttcaggggtttctt
cccgatcggaacaaaaccggggaatggagcgagcctgtctgtgagcaaaccatcagtgac
gagagcgcccccgtctggatcgtggtgacggttgtcctggcggcctccgtgtgcgcctgc
ctgctgctcatgggctgcttcttgctgctgtggtacatctacaagaggaccaagtatgcc
ttctaccccgggaacacgctcccgcagcacctcaaggagttcctgagtcaccctcatcac
aacaggcttctgtttttctcctccccactctccgatgagaatgaagtttttgacaaactg
agtgtcgtcacagaagcctctgaaagcaacaaacagaatcccggggacggctgcagcctc
ggggccccgcctgggggtggggctggccctccaggggttctccaaggagggggcacaccc
cacttcccactgctgcctctgagggtgagcaacaagcgagggccgagaccccctgagcaa
gcccctgtgtag

KEGG   Miniopterus natalensis: 107537477
Entry
107537477         CDS       T05883                                 

Symbol
IFNAR1
Name
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04217  Necroptosis
mna04380  Osteoclast differentiation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107537477 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    107537477 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107537477 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107537477 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107537477 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    107537477 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    107537477 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107537477 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537477 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107537477 (IFNAR1)
   05160 Hepatitis C
    107537477 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    107537477 (IFNAR1)
   05164 Influenza A
    107537477 (IFNAR1)
   05162 Measles
    107537477 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    107537477 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107537477 (IFNAR1)
   05169 Epstein-Barr virus infection
    107537477 (IFNAR1)
   05165 Human papillomavirus infection
    107537477 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107537477 (IFNAR1)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IFN receptor family
   107537477 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac PapD_N
Other DBs
NCBI-GeneID: 107537477
NCBI-ProteinID: XP_016069000
LinkDB
Position
Unknown
AA seq 551 aa
MCVCICNFSFLAPLPGRTRLKPPQDVDVDIVDETFTLRWNGSLASAGSVTFSADYQIPGT
VDNWTELPGCQHVTDTECDFSSLEMNVYEQIKLRVRAEEGHSTSPWHELEPFIPFERAQI
GPPKVHLEAEDKAIIINISPPGAKDSIMWEQDVLSFVYSVVSWRSPSGVQMRNETVYPSF
KIYRLSPETTYCAKVKAGLPLQRNAATFSPVHCVNTTVENKLPSPENVQVALKGQDFVLT
WDYTREDVTFQAQLLSAYLKKIPGSYSEKWAQIQDCEHVTRTQCVLPRSLHSKGIYFVRV
RASRGNSTSYWSEEEKFDVERLTVIPPPVVTLKPAGGNALRVHLGAQDRSAFQHYPLTYE
VSFWENTSDVERTITENGADFLIPHLKLLTVYCVKARALLEDSAWSRRSVFSSPVCEETG
PGNAPRTWLVAVIGAVLAVPLVVYTVTLLMRLVNYVFFPSSKPPATIDEYFPEEPLKNLL
LSTSVEQVEKCFIIENVDIVSIGEASRVSEDPKIYNSQTSQDSGNYSNEDENSGSHASEE
LGRRETVTDAL
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgtgtgtgtgtatctgtaacttttcttttctggcacctttaccagggagaacacgcctg
aaacctccgcaagatgtagacgtcgacatcgtggatgagaccttcacgctgaggtggaat
gggagcctcgcctccgctgggagcgtgaccttctcagcagattaccaaatacctgggacg
gtggataactggacggaactgcctgggtgtcagcacgttactgataccgagtgcgacttc
tcttcgctcgagatgaacgtctatgagcaaatcaaactgcgagtaagagcggaagaggga
cacagcacctccccgtggcacgagctggagcccttcatcccgtttgagcgagctcagatt
ggtcctccaaaagtccatttagaagctgaagacaaggcaataataataaacatctctcct
cccggagcaaaagacagcatcatgtgggaacaggacgttctgagctttgtgtacagcgtg
gtcagctggaggagcccgtcaggggtgcagatgaggaatgaaactgtttatcccagtttt
aaaatctacagactctcaccagagacgacgtactgtgcgaaagttaaggcgggcctgccc
ctgcagaggaacgcggcgaccttcagccccgtgcactgcgtgaacaccacagttgaaaat
aaactgccttctccagaaaacgtgcaagtcgctttgaaaggtcaggactttgtccttacg
tgggattacacacgcgaagacgtgactttccaagcccagttgctgagtgcctatttaaaa
aagatacctggtagctattcagaaaaatgggcacaaatacaggactgtgaacatgtgaca
aggacccagtgtgttctcccgcgaagtcttcactcgaaaggaatttacttcgtccgcgtg
cgagcgtcccgtggaaacagcacgtcctactggtctgaggaggagaaatttgacgttgaa
aggctaactgtcatcccccctccggtcgtgaccctgaagcccgcgggcggcaacgcgctg
cgcgtccacctgggcgcccaggaccggtccgccttccagcactacccgctgacttacgaa
gttagtttttgggaaaacacgtcagatgtggagaggacaattacagagaacggagccgac
ttcctgattccgcacctgaagctgctgaccgtgtactgcgtgaaggcccgagcgctcctg
gaggacagcgcgtggagcaggcgcagcgtattcagcagccccgtgtgcgaggagacgggc
ccaggaaatgctcccagaacctggctggtagccgtgattggcgccgtgctcgctgtccct
cttgtcgtttacactgtgaccctcctcatgagactggtcaactacgtgttcttcccgtcc
agtaaacctcctgccaccatcgacgagtatttccctgaagagccactgaagaatctactg
ctttccacttctgtggaacaagttgaaaaatgttttataatcgaaaatgtagacattgtc
tctataggagaagccagtcgagtcagtgaagatcccaaaatatacaattcccagactagc
caggactcgggaaactactccaatgaagatgagaacagcggcagtcacgcgagcgaggag
ctggggcggcgggaaacggtgaccgatgcgctctga

KEGG   Miniopterus natalensis: 107537520
Entry
107537520         CDS       T05883                                 

Symbol
IL13RA2
Name
(RefSeq) interleukin-13 receptor subunit alpha-2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107537520 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107537520 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107537520 (IL13RA2)
   04090 CD molecules [BR:mna04090]
    107537520 (IL13RA2)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL3 receptor family
   107537520 (IL13RA2)
CD molecules [BR:mna04090]
 Proteins
  107537520 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind LIFR_N
Other DBs
NCBI-GeneID: 107537520
NCBI-ProteinID: XP_016069042
LinkDB
Position
Unknown
AA seq 396 aa
MAFIHLDIRCLYAILICTAFGSTLSSNSEIKVSPPEDFEIVDPGYLGYLYLQWQPPLFLN
NCEECTVEYELKYRNIDSENWKTIITKNLHYKDGFDLNQGIEAKIHTVLQGQCTNGSEVQ
SSWSEATYWTNPQGNVETKIQHMDCIYHNWQYLLCSWEPGMVVDVDTDYNLFYWYEGMDH
ALQCADYIKGNGKNVGCSFPYLEEPDYKDFYICVNGSSESQLIRPSYFILQLQNIVKPLP
PDYLSIIVKNSEEVNLEWNVPKGPIPANCFIYEINFTEDDTTTWTTTFENEMYVTRTSNE
SQELCFLVRSKVNIYCSDDGIWSEWSDIQCWTDGLQNEVLSFLIPFTLVLSFILLITCLL
MTKHKALLKMGFEDDKEFKAPKNGYMALELCRSYDG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctttcattcatttggatatcagatgcctatatgccattcttatttgcacagcattt
ggttctactttgtcttcaaactctgagataaaagtgagtcctcctgaggattttgagata
gtggatcctggatatttaggttacctctatttgcaatggcaacctccactgtttctgaat
aattgtgaagaatgtacggtagaatatgaattaaaataccgaaacattgatagtgaaaac
tggaagaccatcattacaaagaatctgcattacaaagacgggtttgatcttaaccaaggc
attgaagcaaagatacatacagttctgcaagggcaatgcacaaatggatctgaagttcag
agttcatggtcagaagctacttattggacaaatcctcaaggaaatgtggaaacgaaaatt
cagcatatggattgtatatatcacaactggcaatatttactctgctcttgggaacctggc
atggttgttgatgttgatacagattacaacttgttttactggtatgagggcatggatcat
gcactacagtgtgctgattacatcaagggtaatggaaaaaatgttggatgcagttttccc
tatttggaggaaccagactataaagatttctatatctgtgttaatggatcatcagaatcc
cagcttatcagaccgagctattttattcttcagcttcaaaatatagttaaacctttgcca
ccagactatcttagtattattgtgaagaattcagaggaagttaacctggaatggaacgtg
cctaaaggacccattccagcaaattgtttcatttatgaaattaatttcacagaagatgat
actactacctggactaccacatttgaaaatgaaatgtatgtcacaagaacatcaaatgaa
agtcaggaattatgctttctggtgagaagcaaagtgaatatttattgctcagatgatgga
atttggagtgaatggagtgatatacaatgctggacagatggcctacagaatgaagtctta
tctttcttgataccatttactcttgtcttatctttcattttgttaataacttgtctgctt
atgactaagcataaggctttactgaaaatgggttttgaagatgacaaagaatttaaggca
ccaaagaatggttatatggcattggagttatgtaggtcctatgacggttaa

KEGG   Miniopterus natalensis: 107539642
Entry
107539642         CDS       T05883                                 

Symbol
IL9R
Name
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107539642 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107539642 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107539642 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107539642 (IL9R)
   04090 CD molecules [BR:mna04090]
    107539642 (IL9R)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107539642 (IL9R)
CD molecules [BR:mna04090]
 Proteins
  107539642 (IL9R)
SSDB
Motif
Pfam: DUF4390
Other DBs
NCBI-GeneID: 107539642
NCBI-ProteinID: XP_016071695
LinkDB
Position
Unknown
AA seq 485 aa
MGPSSCIWEGWTLQSEALTRGMGTWLLVCIWVGLGDMVPGERGGEGTRAGAFTCLTNNIL
RIDCHWSAPELGQGPSPWLLFTSNNAPGSKHRCVFRTSTCTMVLPPEEVLVPSDNFTITL
HRHISGKEQVSLVDPQYLPRRHVKLDPPSDLQSNVSSDSCVLTWAIGPALEPLASMLSYE
LAFKRQEEAWEWAQHKGHIFGVTWIILEAAELDPGSTYEARLRVQMATLEDTIAEEERYE
GHWSEWSQPVSFPSPQRQGPLVSPLRQPDSTLVAVFVFLLLTSLTYLLFKLSPRVKRTLY
QNVPSPVPFFQPLYSVHSGNFQTWTGAHRAGVQLSQDCVGATQGASESGVRETVAFLTYD
PADPWPFMGLEEEGTGPGLPVDVWPAALESGEEPPAYLPQEEWVPASPARPAPPQSEGSS
SDYCALGCYGGCHPSPFPGTMQSPGPIQALACGLSCDQHSLDARQGSSYVGAGLSQGQDP
GEQAA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgggacccagcagctgcatctgggaaggttggaccttgcagagtgaggccctgactaga
gggatgggcacctggctcctcgtctgcatctgggtcggcttgggagacatggtgccaggg
gaaagaggaggtgagggcactagggctggagctttcacctgcctcaccaacaacatcctc
aggattgactgccactggtctgccccagagctgggccaaggccccagcccctggctcctc
ttcaccagcaacaatgcaccgggcagcaagcacaggtgtgtcttccggaccagcacgtgc
accatggtgctgccgcccgaggaggttcttgtgccttccgacaacttcaccatcactttg
caccgtcacatctctgggaaggagcaggtcagcctggtggacccccagtacctgccccgg
agacatgtgaagctggaccctccctctgacttgcagagcaacgtcagctctgactcctgc
gtcctgacctgggccatcggtcctgccttggaaccactggcctcgatgctcagctatgag
ctggccttcaagaggcaggaagaggcctgggagtgggcccagcacaagggtcacattttt
ggggtgacctggatcatccttgaagctgctgagttggaccctggttctacctatgaggcc
aggctgcgtgtccagatggccaccctggaggacaccatcgcggaggaggagcgctatgag
ggccactggagtgaatggagccagcccgtgagcttcccctctccccagaggcaaggcccc
ctggtttcacctttgaggcagcccgacagcacccttgtcgctgtgttcgtctttctcttg
ctgaccagcctgacttacctcctgttcaagctgtcacccagggtgaagagaaccttgtac
cagaacgtgccgtccccggtgcccttcttccagcccctctacagtgtgcacagcgggaac
ttccagacctggacaggggcccacagagctggtgtgcagctgagccaggactgtgtcggt
gccacacaaggagcctcggagtccggcgtccgggagaccgttgcgttccttacctatgac
ccggcggatccctggccattcatgggcctggaggaggagggcactggccctggactcccg
gtggatgtgtggccagcagccctggagtcaggagaagagccacctgcctacctgccgcaa
gaagaatgggtccctgcgagccctgccaggccagctcccccacaatcagagggcagtagc
agtgactactgtgccctgggctgctatggggggtgtcacccttcgcctttcccaggaacc
atgcagagtcctgggcccatccaggccttggcctgtggcctttcctgcgaccagcatagc
ctggatgccaggcaaggaagtagctatgtgggagctggtctcagtcaggggcaagaccct
ggggaacaggctgcatga

KEGG   Miniopterus natalensis: 107539652
Entry
107539652         CDS       T05883                                 

Symbol
IL21R
Name
(RefSeq) interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04659  Th17 cell differentiation
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107539652 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107539652 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107539652 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    107539652 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107539652 (IL21R)
   04090 CD molecules [BR:mna04090]
    107539652 (IL21R)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107539652 (IL21R)
CD molecules [BR:mna04090]
 Proteins
  107539652 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind Phage_holin_T
Other DBs
NCBI-GeneID: 107539652
NCBI-ProteinID: XP_016071704
LinkDB
Position
Unknown
AA seq 544 aa
MLRGWAAALLLLVFQGAWGCSDLVCYTDYFQTVTCFLETWTFHPSTLTLTWQDLFGELED
EVTSCSLRRSSHNATHAKYTCHMDVFHFMADDIFSVNMTDQSGNHSQECGSFVLATSIKP
SPPFNVTVTFSGRYNISWSSNYDLYGLKGKLQYELRYRKQGDLWTLSPGRKLISVDTRSV
SLLPLEFHGDSSYELQVRAGPQPGSSFQGTWSEWSDPVIFHTQPEETKGGWHTDLLYLAL
VFTLPILVYLGLKIRLPWRLWKVWVQVPSPEPFFQHLYVNHRGNFKKWVGTPFSASSLEL
SPWNSGVPSTLEIYNFCPPLNAVQGPEATLLPTTLLPGPADLVEADGVPEPGSWGPAPST
AGSGGSSAYQEGDRPYGLVSIDTVTVADTEEPCAWPCTCEEDGYPALNLDAGLEPGAGTE
DPLLGTEATVLSCGCVAAGGPAGLGGPLGSLLDKLMLPLEDEAGWAPGPPWGSGPSRGVC
DSEASSPPAGLDMDTFDSGFAGSDCGSPVECDFTSPRDEGPPRSYLRQWVVMAPPPAGPG
PQAS
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgctgcgtggctgggccgctgctctgctcctgctggtgttccagggcgcctggggttgc
tcagaccttgtctgctacaccgattacttccagacggtcacctgcttcctggagacgtgg
acctttcaccccagcactctcaccctcacctggcaagacctgttcggagaactggaggac
gaggtcacctcctgcagcctccgccggtccagccacaatgccacgcatgcgaagtacacg
tgccacatggatgtgttccacttcatggccgacgacattttcagcgtcaacatgacagac
cagtctggcaaccactcccaggagtgtggcagctttgtcctggccacgagcatcaagccg
tctcctcctttcaacgtgaccgtgaccttctcgggacgttataacatctcctggagctcc
aattatgatctgtacggactcaagggcaaacttcagtatgagctgcggtacagaaagcag
ggagacctctggacgctgagtccagggagaaagctgatctcagtggatacgagaagtgtc
tccctccttcccttggagttccacggagactccagctatgagctgcaggtgcgggcaggg
ccccagcccggctcctccttccaggggacctggagcgagtggagtgacccggtcatcttt
cacacccagccagaagagacgaagggaggctggcacacggacctgctgtacctcgccctc
gtcttcacgctccccatccttgtctacttaggtctgaagatccgcctgccttggaggctg
tggaaggtgtgggtgcaggtgcccagcccagagccattcttccagcacctgtatgtgaac
cacagaggaaacttcaagaaatgggtgggtacacccttcagtgcctccagcctggagctg
agcccctggaactcaggggtgccctcgaccctggagatatacaacttttgcccaccgctg
aatgcagtccagggtccggaggccaccctgctgccgaccacgctgttgccggggcctgcg
gacctggtggaagccgacggggtgcctgagccgggctcctggggccccgccccctccacg
gcgggcagcgggggcagctcagcttaccaggagggggaccggccctatggcctggtgtcc
atcgacacggtgaccgtggcggatacagaggagccatgtgcctggccctgtacctgtgag
gaagatggctacccagctctgaacctggacgctggcctggagcctggcgcaggcactgag
gacccgctcttgggtactgaggccacagtcttgtcctgtggctgcgttgcagctggtggc
cctgccgggctggggggtcccctgggcagcctcctggacaaactgatgctgccccttgaa
gatgaggctggttgggcgccagggccgccttggggtagtgggccatccagaggggtgtgt
gacagtgaggcgagctcgccccccgctggcctggacatggacacgtttgacagcggcttt
gcaggctctgactgcggcagccccgtggagtgcgacttcaccagccccagggacgaaggg
ccccccaggagctacctccgccaatgggtggtcatggctcctccccccgcaggacctggg
ccccaggccagctag

KEGG   Miniopterus natalensis: 107539670
Entry
107539670         CDS       T05883                                 

Name
(RefSeq) interleukin-4 receptor subunit alpha-like
  KO
K05071  interleukin 4 receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna05200  Pathways in cancer
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107539670
   04151 PI3K-Akt signaling pathway
    107539670
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107539670
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107539670
   04658 Th1 and Th2 cell differentiation
    107539670
   04659 Th17 cell differentiation
    107539670
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107539670
  09163 Immune disease
   05321 Inflammatory bowel disease
    107539670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107539670
   04090 CD molecules [BR:mna04090]
    107539670
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107539670
CD molecules [BR:mna04090]
 Proteins
  107539670
SSDB
Motif
Pfam: IL4Ra_N fn3 EpoR_lig-bind LRRC37AB_C
Other DBs
NCBI-GeneID: 107539670
NCBI-ProteinID: XP_016071730
LinkDB
Position
Unknown
AA seq 789 aa
MGWLGSGLTFPVSCLILVWAAGSGSVRPTCFSDYLSTSTCEWEMGSAANCSAELRLTYQL
DFPDSENRTCVPENKGSAVCLCHMLMDDIASGDTYQLDLWAGQQWLWSGTFRPSEHVKPR
APRNLTIDNSASGQWQLTWSIPYSHESFLHLELSYMVNISNDNDPTEFVVYNVTYLEPIL
RFSATTLKPGAFYSARVKAWAQGYDSLWSEWSPSVKWFNYYTWPWEQHLPLAVSVTCIVI
LIICLFCYFSIIKIKKEWWDQIPNPAHSRLVAIVIHESQAPPWGKRAGGQEPAKCPHWKT
CLAKLLPCLLEHGVGKADSSSKAARSGPVQGPGGPAWRPVEVSRTVLWPESISVVKCVEL
LEAAVESEEEAGEGRGSLCPSPESSGGFQEGRAGIAARLTESLFLDLLGGEDGGFSQGFG
EPCPLPPSGSVSAHMPWAEEPSEEPQELSHQGGEQPSGPEPTPPATLTQSPDCPAGTELP
AVVITDNPSYRSFSTLPSQSSGPGELDADPQLAPCLGDGDPHMLSAPQPPEPESWEQALR
RSVLQHRAATARAPAPAGGYRQFAHAVAQGCGPSGEAGYKAFSSLLPSGALCPGTSEVEA
SSGEGCYRPFQSITSGCSGVPSSVPLFTFGLDMEPPHSPQNSPLRSSSPECPSLEPVAKG
EDSQKLPLFLEQATDPLRDDLGSGIVYSALTCHLCGHLKQCHGQEERGKAHVVAAPCCGC
CCGDRSESPVSPLPPVVPLESNLPLASLVPLGVSEEGKSSPFFQPGPSNAQSSSQTLQMV
AMLSTGPHS
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggggtggcttggctctgggctcacattccctgtgagctgcctgatcctggtgtgggca
gcaggctctgggagtgttcggcccacctgcttctccgactacctgagcacctccacctgt
gagtgggagatgggcagtgccgccaactgcagcgccgagctccgcctcacctaccagctg
gactttccggactccgaaaaccgcacgtgtgtccctgagaacaaggggagtgcagtgtgc
ctgtgccacatgctgatggatgacatagccagtggggacacctaccagctggacctttgg
gctgggcagcagtggttgtggagtggcaccttcaggcccagtgagcatgtgaaacccagg
gcccccagaaacctcacgattgacaacagcgcctcgggccagtggcagctgacctggagc
atcccgtactctcatgagagcttcctgcacctcgagctctcctatatggtcaacatttcc
aatgacaacgaccccacagagttcgtagtctacaatgtgacctacttggagcccatcctc
cgcttctcagccaccaccctaaagcctggggctttctacagcgcacgggtgaaggcctgg
gctcaggggtacgacagcctgtggagtgagtggagccccagcgtcaagtggtttaactac
tacacgtggccctgggagcagcacctcccactcgccgtcagcgtcacctgcattgtcatc
ctgatcatctgcctgttctgctatttcagcatcatcaagattaagaaagaatggtgggac
caaattcccaacccggcccacagccgccttgtggctattgtcatccacgagtctcaggcg
ccaccgtgggggaagagggccggaggccaggaaccagccaagtgcccacactggaagact
tgtctggctaagctcctgccctgtttgctggagcatggcgtgggcaaggctgacagttcc
tccaaggctgcaagaagcgggcctgtccagggtcctggaggaccagcgtggcgccctgtg
gaggtcagcaggacggtcctctggccagagagcatcagcgtggtgaagtgcgtggagctg
ttagaggccgcggtggagagcgaggaggaagcgggcgaaggtagagggagcctctgcccc
tcgcctgagagcagcgggggcttccaggagggcagggcgggcatcgcggcccggctgaca
gagagcctgttcctggacctcctcgggggtgaggatggcggcttttcgcagggcttcggg
gagccctgccctcttccaccttcaggaagcgtgagcgcgcacatgccttgggctgaggaa
ccaagtgaggagccccaggagctgtcgcatcaggggggggagcagccttctggcccagag
ccaacccctccagccactctgacgcagagcccagactgcccggctggcacagagctgccc
gctgtcgtcatcacagacaacccctcttaccgcagcttcagcaccctgcccagccagtcc
tcgggtcctggagagcttgacgcagacccacagctggccccctgcctgggggatggggac
cctcacatgctctctgctccccagccccccgagccggaaagctgggagcaggccctccgc
cggagcgtcctgcagcacagggcggccacggcccgcgccccggcccccgccggcggctac
aggcagttcgcgcacgcggtggcgcagggctgcggcccttccggggaggctgggtacaag
gccttctccagcctgctccccagcggtgccctctgcccaggcacgtctgaggttgaggcc
agcagtggggaggggtgctacaggccctttcagagcatcacttctggctgctctggggtt
ccctcttcagtccccctgttcacctttggactggacatggagccacctcacagccctcag
aactcacccctccgcagcagctccccagagtgccccagtctggagccagtggcaaaggga
gaggacagccagaagctcccactcttcttggagcaggccacagaccccctcagggatgac
ctggggagtggcatcgtctattcagccctcacctgccacctgtgtggccacctgaagcag
tgtcatggccaggaggaacgtggcaaggcccacgttgtggccgccccctgctgtggctgc
tgctgtggagacaggtccgagtccccagtgagccccctgccacctgtggttccactggag
tctaacctccctctggcctccctggtacccttgggtgtctcagaggagggcaagtcctcc
ccgttctttcaacctggccccagcaatgctcagagctcaagccagaccctccaaatggtg
gccatgctctccacaggcccacactcatga

KEGG   Miniopterus natalensis: 107541834
Entry
107541834         CDS       T05883                                 

Symbol
IFNLR1
Name
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107541834 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107541834 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107541834 (IFNLR1)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL10/28 receptor family
   107541834 (IFNLR1)
SSDB
Motif
Pfam: Interfer-bind
Other DBs
NCBI-GeneID: 107541834
NCBI-ProteinID: XP_016074506
LinkDB
Position
Unknown
AA seq 369 aa
MCLKNQDLYNKFKGRVRVVSASTKSPWVESKYLEYLFEVEPAPPILVVTRAEEILKVNAT
YQLPPCMPSSNLKYEVDFWKEGTRNKTRFPATLHGQPVQIPLQLDTGGHHCISARTIYTF
GDPKYSEFSKPTCFSLETPGVNWAFLVLLPLLLPLLLVIATGHVIWKSFARNPWLQRTKM
PQALDFSGHRHPVATFQPSVPESLDDLTLCPQKKWTRRVRLSPRGRAPATILAGPGEDTD
DNISLQPYLTASCFLEQEQQSPGHPEAGLQAGEGCPAWGASDGSWASTVGSSLLDEAGSS
GCLANKGWSRCQEPLPLLDFSKDLGSLEELQREDISWANWGSSSPRLDLVPGEPPVSLRT
LKVWDSNTE
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgtgcctgaagaatcaggacctatacaacaagttcaaggggcgcgtgcgcgtggtttca
gccagcaccaagtccccctgggtggagtccaagtacctggagtacctttttgaagtggag
ccggccccgcccatcctggtagttactcgggcagaggagatcctgaaggtcaatgctaca
taccagctgcccccctgcatgccctcatcgaatctgaagtatgaggtggatttctggaag
gaggggactaggaacaagacccgatttccagccaccctgcatggccagccagtccagatc
cccctccagctggataccggtggacaccactgcatcagcgccagaaccatctacaccttc
ggtgaccctaaatacagcgagttctccaagcccacctgcttctccctggagaccccagga
gtcaactgggcattcctggtgctgctcccacttctgctgcccctgctgttggttattgcc
acagggcatgtgatctggaagagctttgcaaggaacccctggctgcagcggacaaagatg
ccacaggctctagacttttctggacacagacaccccgtggcaacctttcagccgagtgtt
ccagagtccctggatgacttgaccctctgtccccaaaagaaatggaccagaagggtcaga
ctgagccctagaggcagggccccagccaccatcctggcaggaccaggggaggacacagac
gacaacatcagtctccagccctacctgacggcctcctgtttcctggagcaggagcagcag
agcccggggcaccccgaggcagggctccaggccggcgaaggctgccctgcttggggtgcc
tcagacggaagctgggccagcaccgtcggctcctccctcctggatgaggctgggtcctct
ggctgtttggccaacaagggttggagcaggtgtcaggagcctctcccactcctagacttc
tccaaggacttgggttccctggaggagctccagagagaggacatctcctgggccaactgg
ggctcctcttcaccaaggctggatctggtccctggggagcctccagtttctcttcggaca
ctgaaggtctgggacagcaacacagag

KEGG   Miniopterus natalensis: 107542211
Entry
107542211         CDS       T05883                                 

Symbol
IL22RA1
Name
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107542211 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107542211 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107542211 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107542211 (IL22RA1)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL10/28 receptor family
   107542211 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 107542211
NCBI-ProteinID: XP_016074957
LinkDB
Position
Unknown
AA seq 575 aa
MRTLLTILAAGSLAAHIAEDASDLLQHVKFQSSNFENILTWDSGLDSAPDTVYSVEYKTY
GEIEWLAKQGCQRITRKFCNLTLETASVSELYYARVTATSAGGRSATKMTDRFSSLQHTT
IKPPDVTCVPKVRSIQMTVHPTSTPLHAGNGHRLTLEDIFHDLFYRLDLQVNKTYQMHLG
GKQREYEFVGLTPDTEFLGTITIFVPTWSKESAPYVCRVRTLPDPTWTYSFSGAFLFAMG
FLVAGLCYLSYRYVTKPPPPPNSLNIQRVLTFQPLRFIQEHVLIPVLDLSGPGSLAQPGQ
YSQVMVSGPREPPGAPPLHNISKITYLEQSDIVFQPSRMPPQQTPSPLSYAPQAASEVRP
PSYTPQVTPKAKAPSYTPQAVSSYTPQASPDSWPPSYGVCMEGSGKDSPPGTLSSSKHLR
TKGQLQKEPPADSCITGDLSLQGMASTTMEEPQEAKSFHQHLCVHMDRAPDTNVLHKGEP
GTQGYLKGQLPLLSSVQIEGHPVSLPLETPSPSCSPMDQVSSPWGLLESLMCSKDEGPVS
ETEAKSTGPRASDLEQPTELDSLFRGLALTVQWEP
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgaggacactactgaccatcctggctgcgggatccctggctgctcacattgctgaggac
gcctcggatctccttcagcacgtgaaattccagtccagcaacttcgaaaacatcctgact
tgggacagcgggctggacagcgccccagacacagtctacagtgtcgagtataagacgtac
ggagagatcgagtggctggcgaagcagggctgccagcggatcacccggaaattctgcaac
ctgaccctggagacggccagcgtctccgagctctactacgcgcgggtcacggccaccagc
gcgggaggccgctccgccaccaagatgacagaccggttcagctcgctgcagcacactacc
atcaaaccacctgatgtgacctgtgtccccaaggtgagatccatccagatgactgtccat
cccacctccacgcccctccacgcagggaatggccaccggctaaccctggaggacatcttc
catgacctgttctaccgcttagacctccaggtcaacaaaacctaccaaatgcaccttgga
ggaaagcagagggaatacgagttcgttggcctgacccccgacacggagttccttgggacc
atcacaatttttgttccaacctggtccaaagagagtgccccctatgtgtgccgtgtgagg
acactgccagacccgacgtggacctactccttctcaggggccttcctgttcgccatgggc
tttctggtcgcggggctctgctacctgagctacagatacgtcaccaagcctcctccgcct
cccaactccctgaacatccagcgtgtactgaccttccagcctctgcggttcatccaggag
cacgtcctgattcctgtccttgacctaagcggccccggcagcctggcccaacctggccag
tactcccaagtcatggtctctgggcccagggagcccccaggagccccaccgctgcacaac
atatctaagatcacctaccttgagcagtcggacatcgtgttccaaccctccaggatgcca
cctcagcagacaccgtccccgctgtcctacgctccccaggctgcctctgaggtcaggccc
ccatcctacacacctcaagtcacccccaaagctaaagccccatcctacaccccacaggcc
gtctcttcctacacccctcaggccagtccggacagctggcctccttcctatggagtgtgc
atggaaggctctggcaaagactcccctcctgggacactctctagttccaaacacctcagg
actaagggccagctccagaaagagccaccagctgacagctgcatcacaggtgacctttct
ctgcaggggatggcctccacgactatggaggagccccaagaagcaaaatccttccaccag
cacctgtgtgtccacatggacagagcacctgacactaacgtgttgcacaagggggagcca
gggacacaggggtacctgaagggccagctgcccctcctctcctctgtccagatcgagggc
cacccggtgtccctccctttggagactccttccccctcgtgttctcccatggaccaggtt
tccagtccctggggcctgctggagtccctcatgtgttccaaggacgagggtccagtgtcc
gagactgaggccaagagcacaggccctcgggcctcagacctggagcagcccacagagctg
gactctcttttcagaggcctggccctgactgtgcagtgggagccctga

KEGG   Miniopterus natalensis: 107542420
Entry
107542420         CDS       T05883                                 

Symbol
IL2RA
Name
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04144  Endocytosis
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107542420 (IL2RA)
   04151 PI3K-Akt signaling pathway
    107542420 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107542420 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107542420 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107542420 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107542420 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    107542420 (IL2RA)
   04659 Th17 cell differentiation
    107542420 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542420 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107542420 (IL2RA)
   05162 Measles
    107542420 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107542420 (IL2RA)
   04090 CD molecules [BR:mna04090]
    107542420 (IL2RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107542420 (IL2RA)
CD molecules [BR:mna04090]
 Proteins
  107542420 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 107542420
NCBI-ProteinID: XP_016075217
LinkDB
Position
Unknown
AA seq 275 aa
MELHLLMWKFFTFIMVTGCVTEFCVSPPDVRHATFKALTYKTGTLLNCECKKGFRRKINQ
SAFMNCTGAAGHSSWENQCQCVRTSPRGTDKQATPKPEEQKERKTTEMQNQMHPTDQVNL
LGHCREPPPWEHEASGRIYHFVVGQRVHYECAQGFRALQRGTAESICEMIRGATRWTQPK
LKCTSESKNDQFLGDEESQTSTDTPSGSETPWPLITAGTTIDFKKHTEVDTPTEMFIFTT
EYQIAVASCVLLLISILLLSAFTWQQRWRKSRRTI
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagctacacttgctgatgtggaaattcttcacattcatcatggtaactggctgcgtg
acagagttttgcgtctccccgccagatgtcagacacgccacattcaaagccctcacgtac
aaaacaggcacactgttaaactgtgaatgcaagaaaggcttccgcagaaaaatcaaccag
tcggcctttatgaattgtacgggagctgctggccactcttcctgggaaaaccagtgtcag
tgcgtgaggacttcccccaggggcacagacaaacaagcaactcctaaacctgaagaacag
aaggaaagaaaaaccacagaaatgcaaaaccaaatgcatcccacagaccaagttaacctt
ctaggccattgcagggagcctccaccatgggagcatgaagcttcagggagaatttatcat
ttcgtggtgggccagagagttcactacgagtgtgcccagggattcagggccctacagaga
ggtactgccgagagcatctgcgaaatgatacgcggggcaacgaggtggacacagcccaag
ctcaagtgcaccagtgaaagtaagaacgatcagtttctaggtgatgaagagtctcaaaca
agcacagatactccttctggaagtgaaactccctggcccttgataacggcaggtactact
atagattttaaaaaacatacagaagtggatacacccacggagatgttcatatttaccacc
gagtaccagatagcagtggccagttgcgttctcctgctgatcagtatcctccttctgagt
gcgttcacgtggcagcagagatggaggaagagtagaagaacaatctag

KEGG   Miniopterus natalensis: 107542422
Entry
107542422         CDS       T05883                                 

Symbol
IL15RA
Name
(RefSeq) interleukin-15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04672  Intestinal immune network for IgA production
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107542422 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107542422 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    107542422 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542422 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107542422 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107542422 (IL15RA)
   04090 CD molecules [BR:mna04090]
    107542422 (IL15RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107542422 (IL15RA)
CD molecules [BR:mna04090]
 Proteins
  107542422 (IL15RA)
SSDB
Motif
Pfam: Sushi NVEALA
Other DBs
NCBI-GeneID: 107542422
NCBI-ProteinID: XP_016075218
LinkDB
Position
Unknown
AA seq 338 aa
MARQRLRGCWVRDLPALLLLLLLRPPATPGRERRAPGTXXGTAGRREAGEPHGDDADHPT
YDGREAVGEERAVTKVEPSGEIHLASGFFQKSTTCSTPTSIEHASIQVKSYNENSRERYI
CNSGFKRKAGTSSLTKCLHNEDTNITQWTIPTLKCIRDPSLTHQRPSSTVVPAGVTPEPE
SPSPSGKEPAFTSKSDTTVATKPATIPGSRLMPSKPPSAGTTGVVRNPQTPSQATAKASE
HTPTASLEKPGAHSYNSTAVIVTAISVPITVLCGVCVVAFLLVRCYKKSRQTSWMPSVQM
ENMEDIPMTGGTNGGEDNTENDHTALETPGENQGQQGL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggcccgccagcggctccgggggtgctgggtccgcgacctccccgcgctgctgctgctg
ctgctgctccggccgccggcgacgccgggtagggagaggcgtgcgcccgggacggnnnnc
gggacggcgggacggcgggaggccggggagccgcatggggacgacgctgatcaccccacc
tatgacggccgtgaggcggtcggagaggaaagagctgtcacaaaagtagagccgtctggg
gaaattcaccttgcctctggtttcttccaaaaaagcaccacatgctctactccaacatct
attgaacacgcaagcatccaggtcaagagttacaatgagaactccagggagcggtatatt
tgtaactctggtttcaagcgtaaagccggtacatccagcctgactaagtgcctgcataac
gaggacacaaacatcactcagtggacaattcccactctcaagtgcatcagagacccctcc
ctgacacaccaaaggccatcttccacagtagtgcctgcaggggtgactccagagccagag
agcccctctccttctggaaaagagccagctttcacttccaaatcagacaccacagtggcc
acaaagccagctactataccaggctccaggctgatgccatcaaaacctccttctgcagga
accacaggggtagtcaggaacccccaaactccatctcaggcaacagcaaaggcctcggaa
cacactcccaccgcctcgctcgagaagccaggtgcacattcatacaattccacagctgtc
attgtgacagcaatctccgtgcctatcactgtgctttgtggagtatgtgtggtggcattt
cttctggtacgttgttacaaaaaatcaaggcaaacttcctggatgcccagtgttcaaatg
gaaaatatggaagatataccaatgactgggggaaccaatggcggagaggacaacacagaa
aatgaccacacagccttggaaactccaggggaaaaccagggccagcaagggctatag

KEGG   Miniopterus natalensis: 107542574
Entry
107542574         CDS       T05883                                 

Symbol
CSF3R
Name
(RefSeq) granulocyte colony-stimulating factor receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107542574 (CSF3R)
   04151 PI3K-Akt signaling pathway
    107542574 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107542574 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107542574 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542574 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107542574 (CSF3R)
   04090 CD molecules [BR:mna04090]
    107542574 (CSF3R)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  Prolactin receptor family
   107542574 (CSF3R)
CD molecules [BR:mna04090]
 Proteins
  107542574 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind ObR_Ig fn3_2
Other DBs
NCBI-GeneID: 107542574
NCBI-ProteinID: XP_016075421
LinkDB
Position
Unknown
AA seq 841 aa
MVGLGAWSLTRAALIILLLPRSLEECGHISLSAPIVRLGDAITASCIINQTCSHLGPESQ
IVWKLGTELQQGGRQQRLADGTLESTITLPHLNDPWVLLSCCLRWSNSLQILDQAELQAG
YPPSTPHNLSCLMNLTTDSLTCQWEPGPDTHLSTNFTLKSFKSRGNCQIQEEAIPDCVPE
DGKSHCSIPRKHLQLYQSMGIWVQVENVLGTSVSPQLCLDPMDVVKLEPPTLWALDPSPE
AAPPQPGCLQLGWESWKPSLYIDQKCELRLQPQLGEASWILVDSLPSRTLQHELCGLLPS
TAYTLQMRCTRWPLPGHWSDWSPSLELTSAQWAPNVRLDTWWRQRQLDPRTVDVQLFWKP
MPLEEASGEIQGYLVSWRPPGQAGAVPPLCNTTELSCTFHLPLEVREVVLVAYNTAGTSP
PTPVVFLDRRGPPLGRLHTVAQDPHSLWVGWETPSPQPRGYVIEWGLGPPSPSSSNKTWK
MEHNGSIAGTLLQENIRPFQLYEITVTALYQDTMGPSQRIYAYSQETAPSYTPELHLKHI
GKTWAQLEWAPPAPELGRSPLTHYTIFWTSAQGQSFSTILNASSHGFVLPGLEPASLYHV
YLTAASQAGATNSTSLTLMTLAPEESELHIFLGLFSLLLLLICLCGAARLCCRASRKNPL
WPSVPDPAHSSLGSWVPSITAEEIFQLPSLWDPSMPPITKITVLEEEEKKPGPWESNDGS
GTCSLPTLVQAYVLQGDPRAPSIQPQSQSGNSDQVLYGQVIGSPTGSEPGHYIRCDSTQP
LLGGLTPSPKSYENLWFQPSPVRTSEPLVPNQEDDCVFGPLLDFPLLQGLQVHGVEGLGG
F
NT seq 2526 nt   +upstreamnt  +downstreamnt
atggtggggctgggagcctggagcctgaccagagctgctctgatcatcctgctgctcccc
agaagcctggaggagtgcgggcacatcagcctctcagcccccatagtccgcctgggagat
gccatcacggcttcctgcatcatcaaccagacctgcagccacctgggcccagagtcacag
attgtatggaaattgggaacagagcttcaacaaggggggaggcagcagcgcctggcggat
ggcaccctggaatctaccatcaccttgccccacctcaacgacccttgggtccttctctcc
tgctgtctgcgctggagcaacagcctgcagatcctggaccaggctgagctgcaggcaggc
tacccaccctccacaccccacaacctgtcctgcctcatgaacctcacaactgatagcctc
acctgccagtgggagccaggacctgacacccacctgtctaccaacttcaccctaaaaagc
ttcaagagccggggcaactgccagatccaggaggaagccatccccgactgtgtgcctgag
gacggaaaaagccactgctccatcccacgcaaacacctgcagctctaccagagtatgggc
atctgggtgcaggtggagaatgtgctggggaccagtgtgtccccacagctgtgccttgat
cccatggatgttgtaaaactggagccccccacactgtgggccctggaccccagccctgag
gcggccccaccccagccaggctgcctacagttgggctgggagtcatggaaaccaagcctt
tacatagaccagaagtgtgagctgcgcctccagccacagcttggagaagccagctggatc
ctggtggactccctgccctccaggacccttcagcatgagctctgcgggctcctcccatcc
acagcctacactctgcagatgcgctgcacccgctggcccctgcctggccactggagtgac
tggagccccagcctggagctgacgagtgcacagtgggcccccaatgtcagactggacacg
tggtggcggcagaggcagctggaccccaggacagtggacgtgcagctgttctggaagcca
atgcccctggaggaagccagtggggagatccaagggtacctggtctcctggagaccccca
ggccaagctggagcagtcccacccctctgcaacaccacggaactaagctgcaccttccat
ttgcctttggaagtccgggaggtggtccttgtggcctacaacaccgctgggacctctcct
cccaccccagtggtcttcttggaccgcagaggccctcccctgggcagactccatactgtg
gcccaagaccctcacagcctctgggtgggctgggaaacccccagccctcagcctcggggc
tatgtgattgagtggggcctgggtccccccagccccagcagcagcaataagacctggaaa
atggagcacaacgggagcattgcagggaccctgctgcaagagaacatcaggccctttcag
ctctacgagatcactgtgaccgccctgtaccaagacaccatggggccctcccagcgcatc
tatgcctattcccaagaaacggccccctcctacaccccagagctgcatctaaagcacatt
ggcaagacctgggcccagttggagtgggcgcccccagcccctgagctggggaggagtcct
cttacccactacaccatcttctggaccagtgcccagggccagtccttctccaccatcctt
aacgcttcctcccatggctttgtcctacctggcctggagcccgccagcttgtaccacgtc
tacctcacagctgccagccaggcaggggccaccaacagcacaagcctcaccctgatgacc
ttggccccagaggagtccgagctgcacatcttcctgggcctgttcagcctcctgctcttg
ctcatctgcctgtgtggggctgccaggctctgctgcagagccagcaggaagaatcccctc
tggccaagtgtcccagacccagcccacagcagcctgggctcctgggtgcctagcatcaca
gcggaggagatcttccagctgcccagcctttgggaccccagcatgccacccatcaccaag
atcaccgtgctggaggaggaagagaagaagccagggccatgggagtccaatgacggctca
ggaacctgcagccttcccaccctggtccaggcctatgtgctccagggggacccaagagca
ccttctatccagccccagtcccagtctggcaacagtgaccaggtcctttatgggcaggtg
ataggcagccccaccggctcagagccagggcactacatccgctgtgactccactcagccc
ctcttggggggcctcacccccagccccaagtcctatgagaacctctggttccagcccagc
ccagtaaggacctcagagcctctagtcccaaaccaggaggatgactgtgtctttgggcca
ctgcttgacttccccctcctgcaggggctccaggtccatggggtggaagggctgggaggt
ttctag

KEGG   Miniopterus natalensis: 107542708
Entry
107542708         CDS       T05883                                 

Symbol
MPL
Name
(RefSeq) thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107542708 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107542708 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107542708 (MPL)
   04090 CD molecules [BR:mna04090]
    107542708 (MPL)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  Prolactin receptor family
   107542708 (MPL)
CD molecules [BR:mna04090]
 Proteins
  107542708 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind LIFR_N
Other DBs
NCBI-GeneID: 107542708
NCBI-ProteinID: XP_016075630
LinkDB
Position
Unknown
AA seq 645 aa
MPSWALLVVTSCLLLVPQNLAQVTSQDASLLASDPEPLNCFSRTFEDLTCFWDEEGAAPS
GTYQLLYAYPGEEPRACPLSSQNMSPFGTRYVCQFPALDDVRLFFPLRLWVKNVFLNLNL
TQRVLFVDHVGLPAPPNIIKAMGGSQPGELQISWKAPTPEISDFLRHQLRYGPKDPRNST
GSTVMQLLSTETCCPALRRPNPAPALDQPACAEPMRPQQDRPEQTFPTREAPSLTVMSGS
CLISGLQPGNSYWLQLRSQPDGVSLHGSWGPWSHSATVDLPGDAVEIGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHGRPWCCPRDRDPIWEKCEAEEKNPGLQPSQFSRCHFKSRNDSV
IHILVEVTTAQGAFHSYLGSPFWIHQAVLIPTPNLHWREVSSGQLELEWQHPSSWAARET
CYQLRYTGEGHQDWKVLEPPLGALGETLELRPRSRYRLQLRARLHGPTFQGPWSAWSDPV
RVETASETADWNVVSMHLARTNKKVRGEGCDAAEPFPQFTRNLRHALWPSLPDLHRVLGQ
YLRDTAALSPPKPAVSDVYEEVEPSLLEILPKSSEKTPLPLCSSQTQMDYRGLQPSCLGT
MPLSVCPPMTESGSYCTTHIANHSYLPLTCWQAPHSQYPGQIQTL
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcttggtggtcacctcctgcctcctcctggtcccccaaaacctg
gcacaagtcaccagccaagatgcctccttgctggcctcggacccagagcccctgaactgt
ttttctcgaacatttgaggacctcacttgcttctgggatgaggaaggggcagcacccagt
ggaacataccagctgctgtatgcctacccaggggaggagccccgtgcctgccccctgagt
tcccagaatatgtccccctttggaactcgatatgtgtgccagtttccagccctggatgat
gttcgtctcttctttccactgcgcctctgggtgaagaacgtgttcctgaacctcaacctg
acccagcgggtgctctttgtggatcatgtgggcctaccagctccccccaatatcatcaaa
gccatgggtgggagccaaccaggggaacttcagatcagctggaaggccccaactcctgaa
atcagtgatttcctgaggcaccaactccgctatggtcccaaggatcccaggaactccact
ggttccacagtcatgcagttgctgtccacagaaacttgctgcccagctctgcggaggcca
aacccagccccagctctggatcagcctgcatgtgcagagcccatgaggccccaacaagac
agaccagaacagaccttcccaactagagaagctccatctctgacagtgatgagtggaagc
tgcctcatctcagggctccagcctgggaattcctactggctccagctgcgcagccaacct
gatggggtctccctccatggctcctggggaccctggtcccactctgcaaccgtggacctg
cctggagatgcagtggaaattggactgcaatgcttcaccctggacttgaagaatgttacc
tgtcagtggcagcaacaggaccacgctagctcccaaggcttcttctatcacggcaggcca
tggtgctgtcccagagacagggaccccatctgggagaagtgtgaagcagaggagaaaaat
ccaggattacaaccctcccagttctcccgctgccacttcaagtcacgaaatgacagcgtt
attcacatccttgtggaggtgaccacagcccagggtgcctttcacagctacctgggctcc
cctttctggatccaccaggctgtgctcatccccacgccaaacttgcactggagggaggtc
tccagcgggcagctggaattggaatggcagcacccatcatcctgggcagcccgagagacc
tgctatcagctccgatacacaggagaaggccatcaggactggaaggtgctggagccgccc
ctgggcgcgctgggggagactctggagctgcgcccgcgctcccgctaccgcctgcagctg
cgcgcgaggctccacggccccaccttccaaggcccgtggagcgcctggtccgacccggtg
cgggtggagaccgcctcggagaccgctgactggaatgtagtctctatgcacctagccagg
accaacaaaaaagttaggggggaaggatgtgatgctgctgaaccttttccccagtttacc
aggaacctgaggcatgccctgtggccctcacttccagacctgcaccgggtcctaggccag
taccttagggatactgcagccctgagtccgcccaagcctgcagtctcagatgtctatgag
gaagtggaacccagcctccttgaaattctacctaagtcctcagagaagactccattgccc
ctatgttcctcccagacccagatggactaccgaggattacagccctcttgcctggggacc
atgcccctgtctgtgtgcccacccatgactgagtcaggatcctactgcaccactcacatt
gccaaccattcctacttaccgctgacctgttggcaggcccctcattcccagtaccctggc
cagatccaaactctctag

KEGG   Miniopterus natalensis: 107543721
Entry
107543721         CDS       T05883                                 

Symbol
IL6R
Name
(RefSeq) interleukin-6 receptor subunit alpha
  KO
K05055  interleukin 6 receptor
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04066  HIF-1 signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna04659  Th17 cell differentiation
mna04932  Non-alcoholic fatty liver disease
mna05163  Human cytomegalovirus infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107543721 (IL6R)
   04066 HIF-1 signaling pathway
    107543721 (IL6R)
   04151 PI3K-Akt signaling pathway
    107543721 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107543721 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107543721 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107543721 (IL6R)
   04659 Th17 cell differentiation
    107543721 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543721 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107543721 (IL6R)
   05163 Human cytomegalovirus infection
    107543721 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107543721 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107543721 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107543721 (IL6R)
   04090 CD molecules [BR:mna04090]
    107543721 (IL6R)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107543721 (IL6R)
CD molecules [BR:mna04090]
 Proteins
  107543721 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_2 Ig_3 ig fn3 IL2RB_N1 I-set
Other DBs
NCBI-GeneID: 107543721
NCBI-ProteinID: XP_016076798
LinkDB
Position
Unknown
AA seq 443 aa
MDRCVNVEVESDVLTSRPGASVILTCPGGELGDNATVHWVLRNHVTGPNHDRWAGLGRRL
LLRSVQLSDSGNYSCYQAGHPVGTVLLLVDVPPEEPQLSCFRKSPVSNVFCEWSPGRAPS
PWTKATLSVRKFQHGPAEDFQEPCQYSQESQKFSCQLAVPEGDNSFHIVSLCVANTAGSK
SSKPQTFEGYGILQPDPPVNITVTAVDRSPRWLVVTWQDPPSWNSYFYRLQFELRYRAER
SKTFTTWMVKELQHRCIIHDAWSGMRHVVQLRAQEEFGHGLWSEWSQEVMGTPWTESTSF
STETTLEVSPSMQVSTTNEGDENIPSNSANTTSFPVQDSPIPLYTFLVAGGSLAFGTLLC
IGIVLRFKKMWKLQALKEGKTSMHPPYSLGQLVPERPKPTPVLVPLISPPVSPSSLGSDN
TLRDSRRPQSPYDISNRDYFFPQ
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggacaggtgtgtgaatgtggaggtggagagcgatgtgctgaccagcaggcctggggcc
agcgtgatcctgacctgtccaggtggggaactgggagacaatgccacagttcactgggtg
ctcaggaatcatgtcacaggcccgaaccacgacagatgggctggcttgggaaggaggctg
cttctgagatccgtgcaactcagtgactctggaaactattcgtgctaccaggctggccac
ccagttggaactgtgctcctgttggtggatgttcctccagaggagcctcagctgtcctgc
ttccggaagagcccggtcagcaacgtgttttgtgagtggagccctgggcgtgccccctcc
ccgtggaccaaggccacgctgtcggtgaggaaatttcagcacgggccagcggaagacttt
caggagccgtgccagtattctcaggagtcccagaagttctcctgccagctggcagtccca
gagggagacaactctttccacatagtgtccctgtgcgtcgccaacactgctgggagcaag
tccagcaaaccccaaacatttgagggttatggaatcctgcagcctgacccgcctgtcaac
atcacagtcaccgctgtggaccgcagcccccgctggctcgtggtcacctggcaagacccg
ccgtcctggaattcgtatttctacaggctacagtttgagctccgataccgggctgaacgg
tcaaagacattcacaacatggatggtcaaggagctccagcatcgctgcatcattcacgat
gcctggagtggcatgaggcacgtggtgcagctgcgagcccaggaggagtttggacacggc
ctgtggagcgagtggagccaggaggtcatgggcacgccctggacagaatccacaagtttt
tcaactgagaccacgctggaggtatccccctccatgcaggtatctactactaatgaaggc
gatgaaaatattccctctaattctgcaaatacgacaagcttcccggtgcaagattctccg
ataccactgtacacattcctggtggccggagggagcctggccttcggaacgctcctctgc
attggcattgtcctgaggttcaagaagatgtggaagctgcaggctctgaaagaaggcaag
accagcatgcacccgccttattctttgggacagctggtccctgagaggcccaagcccacg
ccagtgctcgttcctctcatctccccgccggtgtcccccagcagccttgggtcagacaac
accttgagggacagccgacgcccacagagcccttatgacatcagcaacagagactacttc
ttcccccagtag

KEGG   Miniopterus natalensis: 107543956
Entry
107543956         CDS       T05883                                 

Name
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107543956
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107543956
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107543956
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543956
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107543956
   04090 CD molecules [BR:mna04090]
    107543956
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL3 receptor family
   107543956
CD molecules [BR:mna04090]
 Proteins
  107543956
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 107543956
NCBI-ProteinID: XP_016077187
LinkDB
Position
Unknown
AA seq 448 aa
MAFLWDLASLLVLLSSARFEDAHLVAAEGGLSPVVNMKLDPRRKLLTWNYRRNVTWQECK
IDTPPKFSTRQRPQARDDTYFCRFPNAVVHRGATLTVTVSADGETFQEVLDFRNSGREGS
GAVNFSCLIYDVHLMKCSWRPGPAAPADIQYHLYGWTSRQDREVECPRYIADLRGTHVGC
HFDELVGPQLTETYFFWVNGTSQETAVQFVDVSPLKTIEMEKYNPPANITVQYNGSHHII
RWDNPKMRLGMSSGALCYELDIQREVLQRGSEDNVYVMPSSSASAQHTVRARVKFAYSRL
WSDWSDALRFGCNFKAPAGGHFRLQDAPVRGLPEQDVSGTPVALVGLVVGVAALVTTVLM
FLCTRFSLRGKLFPPVPQVKREVVGTLVPFPEVTWDGHSPPLSLQEPEDILALEEMRPFG
SRQAEMVDPAGPHHHSENISPEHRPLDA
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggcgtttctgtgggacttggcgagcctcctggtgctcctgagctcagcgcgcttcgaa
gacgcacacctggtggctgcagaggggggcctatcgcccgttgtaaacatgaagctagat
ccgagaagaaaactgctgacctggaattatcggagaaacgtgacctggcaagaatgcaaa
atagataccccgcccaagttttccacccggcaacgcccacaggcccgagacgacacctac
ttctgccgattcccaaacgccgtggtgcacagaggcgccaccctgaccgtgaccgtgtcc
gccgacggggagacgtttcaggaagtcctggactttcgcaactcaggcagggaaggctcc
ggggctgtcaacttctcctgcctcatttacgacgtgcacctcatgaagtgtagctggagg
ccgggcccggccgcccccgccgacatccagtatcacctgtacggctggacgtccaggcag
gaccgtgaggtcgaatgtccccgatacatcgctgacttgagggggacccacgtgggctgt
cattttgatgagctcgtgggaccccagctgacagaaacctacttcttctgggtgaacgga
accagccaggagaccgccgtccagttcgtggacgtctctccgctgaaaaccattgaaatg
gaaaagtataaccccccagcaaacatcacggttcagtacaacgggtcccatcacattatc
cggtgggacaaccccaagatgagactgggcatgtcgagcggtgccttgtgctacgaactg
gacatccaaagggaggtgttgcaaagagggagtgaggacaacgtctacgtgatgccaagt
tcgtccgcgagcgcccagcacacggtgcgagcccgggtgaagtttgcctacagccggctg
tggagtgactggagcgatgcgctgcgctttggatgcaactttaaggccccagctggtggc
cacttccggctccaggatgcccccgtcaggggcctcccggagcaggatgtcagcggcacc
cctgtggccctcgtggggctggtggtgggtgtggcagctttggtcaccaccgtcttgatg
ttcctatgcacaaggttctccctgagaggaaagctgttccctccagtgccgcaggtgaaa
agggaggtggtgggcaccttagtgcccttcccggaggtcacctgggatgggcacagccca
ccgctgagcttacaggaacccgaggacatccttgcactagaggaaatgaggccctttggg
agcagacaagcagaaatggtggacccagcagggccccaccaccattctgaaaacatcagt
cccgagcatcgtcccctcgatgcgtaa

KEGG   Miniopterus natalensis: 107543957
Entry
107543957         CDS       T05883                                 

Symbol
CRLF2
Name
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107543957 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107543957 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107543957 (CRLF2)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107543957 (CRLF2)
SSDB
Other DBs
NCBI-GeneID: 107543957
NCBI-ProteinID: XP_016077188
LinkDB
Position
Unknown
AA seq 360 aa
MRRDTVEMLPLTIVSRGGTLPFQIINFNFETVRVTWNASEHAGDNLTFFYGFRSEEHSQC
RNYILQEGRTVGCLLEAEGDKILWFSIRNGTQSLLLKSLWISDYLKPNAPKDLNFSWHQE
AMTVTCSNLPYRGLLYEVQHKSAFDTTWQSDVRDTCNITISGLDGDKCYFFRARVMTTES
SYGPEAHPSDWSEVTHRQKGELRASCQEKTLFSRFVFIYCMVASLTLFLFVLCLWKIWRV
KKLLMPNVPDPKFTFPGLFDSHHGNFQEWIKDTQNVTHLNKTEDREQECVLEEALVIQLP
KTEAETPETTMTSSLCLQTAEKEAAAGEPGPLPCQPPQGGEMLCLKGFMFVMSDNSYVTL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgagaagagacacagttgaaatgttgccgctgactattgtctctcggggaggcacgttg
ccctttcagatcatcaactttaattttgaaactgtgcgggtgacgtggaacgcaagcgaa
cacgcgggggataacttgactttcttctacggattccgcagcgaggaacacagccagtgc
cgcaactatattcttcaggaaggtcgcacggtggggtgtctcctcgaggcagaaggagat
aaaatcctgtggttttccatcaggaacgggacccaaagtcttctcttgaagagtttatgg
atcagtgactatctgaagcccaacgccccgaaagatctgaacttctcgtggcatcaggaa
gcgatgacagtgacatgttccaatctgccctacaggggcctcttgtatgaagttcagcac
aaaagcgcttttgacacaacgtggcagtctgacgtgagagacacgtgcaacattacgatc
agcggcctggatggtgacaaatgttacttcttccgggccagagtgatgaccacggagtcc
agctatggccccgaagcccaccccagcgactggtccgaggtgacacaccgtcagaagggt
gagctgcgagcttcatgccaggagaaaacgcttttctcaagattcgttttcatttactgc
atggtggcctcgctgacgctgttccttttcgtcttgtgcctgtggaagatatggagggtt
aagaagctgctcatgcccaatgtgcctgaccccaaattcaccttccctgggctcttcgat
tcccaccacggaaacttccaggaatggattaaggatacgcagaacgtcacccacttgaat
aagacggaggaccgggagcaggaatgtgtcctggaagaggccctggtcatccagctgccc
aagactgaggccgagactccggagacgacgatgacaagctcattgtgtctgcagacggcg
gagaaagaagcagctgctggggaacccgggccgctcccttgtcagcccccccagggagga
gagatgctctgtctcaagggcttcatgtttgtgatgagtgacaactcttatgtgacgcta
tga

KEGG   Miniopterus natalensis: 107543958
Entry
107543958         CDS       T05883                                 

Symbol
CSF2RA
Name
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107543958 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107543958 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107543958 (CSF2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543958 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107543958 (CSF2RA)
   04090 CD molecules [BR:mna04090]
    107543958 (CSF2RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL3 receptor family
   107543958 (CSF2RA)
CD molecules [BR:mna04090]
 Proteins
  107543958 (CSF2RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 107543958
NCBI-ProteinID: XP_016077189
LinkDB
Position
Unknown
AA seq 402 aa
MGPLVKSILVMVLLDSAFLLTPEHQDLPTTEPIPSPSLNIKFDPWRRNLTWDCRENTTSI
QCVMISNENGEVIKKLKEKECHCTFQDAILHEGIEFMVTVNISQRQITEKMFYSNPGGKD
TGAQNVSCFIYNVDFMNCTWAKGPAAPDDVQYFLYIQDLKRRERHCPRYVKDAGTHVGCH
LEGASELFSHIYIVVNGTSQKADIQFFDKLLMLKKIEIYNPPRNITVHCNRSHCLIQWEK
PRTRLRLPNSEFQYQLDIHRQNSMEHGGNQLVEVFGTSGNKYNFLSPQPRARHTVQIRAA
DYRILLWGAWSHPAEFGSGEWGPSNVPIYVLVILGTLFCVLVLSFIFKRFVGTPIPRIKD
KLSNNHTTDDEIIWEKFTVATAKGDYEEILAVREVGESTASV
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgggtcccctggtgaaatccatcctggtcatggtgctgcttgactcagcattcctcctg
accccggagcaccaggatcttccaaccacggaacctatccccagtcccagtctaaacata
aagttcgacccctggagaaggaacttgacttgggactgcagagaaaacaccacctccatc
caatgtgtgatgattagcaatgaaaacggagaagttataaagaagctcaaggagaaagaa
tgtcattgcacctttcaggatgctattctccacgagggaatcgagttcatggtcacagta
aatatcagccaaagacagattacagaaaaaatgttctactctaacccaggtggcaaggac
acaggggcacaaaacgtctcctgtttcatctacaacgtggatttcatgaactgcacttgg
gccaagggtccggcagcccctgacgacgtccaatattttttgtatatccaagacttaaag
agaagggaaagacactgtccccgttacgtaaaagacgcggggacccacgtgggatgtcac
ctagaaggcgcctcagaattgttttctcacatttacatcgtggtgaacggtaccagtcag
aaagcagacatccagttctttgataagcttttgatgttaaagaaaatagaaatatacaac
ccacccagaaatatcaccgtccactgcaacagatcccactgcctcatccagtgggaaaag
ccgaggacacgcctgagactgcccaactcggagttccagtaccagctggacatccacaga
cagaacagtatggaacacggtggtaatcaactggttgaggtgtttggtacttcgggaaat
aaatacaactttctgagccctcagcccagagccagacacactgtgcagatacgggccgcg
gactacaggatccttctgtggggtgcctggagccatccggctgagtttggatccggagaa
tggggtcccagcaatgtgcctatctacgtgctggtgatcctgggcaccctcttctgcgtc
ctggtcctcagcttcatttttaaaaggtttgttgggacaccaattccgagaatcaaagat
aaattgagcaataaccatacaactgacgacgagatcatctgggagaaatttactgtagca
acagcaaaaggtgactacgaagagatcctggcagtaagagaggtcggggagtccacagcc
agcgtgtga

KEGG   Miniopterus natalensis: 107543962
Entry
107543962         CDS       T05883                                 

Symbol
IL3RA
Name
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107543962 (IL3RA)
   04151 PI3K-Akt signaling pathway
    107543962 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107543962 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107543962 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107543962 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543962 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107543962 (IL3RA)
   04090 CD molecules [BR:mna04090]
    107543962 (IL3RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL3 receptor family
   107543962 (IL3RA)
CD molecules [BR:mna04090]
 Proteins
  107543962 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind LIFR_N
Other DBs
NCBI-GeneID: 107543962
NCBI-ProteinID: XP_016077193
LinkDB
Position
Unknown
AA seq 384 aa
MGTALAMVLLWLPVLLTPISCLLQRDQDPNPPIKNLRMDPRTKSLTWDIHGNVSAIECCI
NSRSNTKAKKNRFCKFYVLPKCKASNYTVKVTTIDGETFSTWIQYPKQEGNPEAAPQNLD
CQVHDKDFLTCSWAVGKEAPSDVQYYFYLENMNTNQKWECSDYTANELGQHIQCQFDDVS
QFSEGQYRFLARGTSNESTVPCSELITFLPDIEKLIAPKITVSCNQSLAFMKWNMSSHFH
KNFDYKLEIQQRSDPPFIQMAPLKNSFMLTNPGTFTVRIRALTILKSPGQWSTPQRFVCD
YEENAFLQIWLTSSLIALATLVTVGTALLLCKRYSVLKMLFPPIPHVKDPTGDNFQDEKM
MAWEDCKRTQQECPVAEVQLLRET
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgggcactgcccttgccatggtcttgctctggctgccggtgctcctgacgcccatctcc
tgtctgctgcaaagggaccaagatccaaacccaccgattaagaacttgaggatggatcca
agaactaagagcttgacctgggacatccacgggaatgtttcggccatagagtgctgcata
aattcaaggtccaacacaaaggccaaaaaaaatcgtttttgcaagttttatgtgcttccc
aagtgcaaagcatccaactacactgttaaagtcactacgattgacggtgagacgttttcc
acgtggatccagtatcccaagcaagaagggaaccctgaggcagccccccagaacctggat
tgccaagttcacgacaaggacttcctgacgtgcagttgggcggtgggcaaggaggccccc
agcgacgtccagtattacttctacttggaaaacatgaataccaaccagaagtgggagtgt
tcagattacacagcgaatgagctggggcaacacatccagtgtcagtttgatgacgtctct
cagttttccgaaggccagtaccgtttcctggcgaggggcaccagcaacgagtccacagtg
ccctgctctgaattaatcacgtttttaccggatatcgagaaattaattgcacccaagata
acagtgagctgcaatcagtctcttgctttcatgaaatggaacatgtcgagccacttccac
aaaaatttcgactacaaacttgaaatacagcagcgctccgatcctcccttcatccagatg
gccccgttgaaaaactccttcatgctgaccaaccctgggaccttcacagtgagaatcaga
gccctgactatattaaaatcacctggacagtggagcaccccccagcgttttgtgtgtgac
tacgaggagaacgcgttcctccagatctggctgacctcgtcgctgatcgcgttggccacg
ctggtcaccgtggggacggcccttctcttatgcaaaaggtactcggtgctgaagatgctg
ttccctcccatccctcatgtgaaggaccccacaggtgacaactttcaggatgagaagatg
atggcctgggaggactgcaaacgcacccaacaagagtgtcccgtagctgaggtgcagctc
ttgagggaaacgtga

KEGG   Miniopterus natalensis: 107544337
Entry
107544337         CDS       T05883                                 

Symbol
IL27RA
Name
(RefSeq) LOW QUALITY PROTEIN: interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107544337 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107544337 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107544337 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107544337 (IL27RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107544337 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 107544337
NCBI-ProteinID: XP_016077691
LinkDB
Position
Unknown
AA seq 648 aa
MRGAWAAPCRLLPRPRPALLPLLLLLRWTSPQGSSGSLQCYGVGPLGDLNCSWEPLGDLG
TPSMLHLQSQKYHSNRTWTVAVPTGQSWVAIPREQFTTSDELLVWGAEAGRPLWPPVFVN
LETQMKPEAPQLDPDVDFSEDYPMEATVQWSPPVWPPHKVLVCQFHYRRCQQISWTLLEP
ELRSIPLTPVEIQDLELATGYEVSGRCRMEKEEDLWGEWSPILSFQTLPSAPKDVWISGD
VCGTQGGQKSLLLWKALGHCVQVSYRVWFQVKGQELIPRETPCCSSSIPAQAEWAAVSAV
NATSWEPLTNLSLVCLGSGSAPRGVVVSSIAGSTELLVTWQQGSGEPQEHVVDWARDGEP
LENLSWVRLPPGNLSALLPGNFEGGVPYRITVTAVSPEGLYPAPSVWRFREELVPLVGPA
LWRLEDAPPGTPVIAWGEVPRHQLRGHLTHYTLCTQSGTRPSVCMNVSGSTQKITLPNLP
WGPCELWMMASTIAGQGPPGPTLRLHLPDNTLKLKILPGFLLLWGLLLTGCGMSLATSGR
CLHLRHKILPRWVWEKVPDPANSNSSQPHIEEVPQAQPPGDLPTLEVEEMEPLAVIESPQ
AYSQLDSGYEKHFLPTPEELGLLGPPSPGPRFWPELIPGQEXGCSFDS
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgcggggggcctgggccgcgccctgccggctgctcccgaggccgaggcccgcgctgctg
cctctgctgctgctgctccgctggacaagtccccagggaagctcagggtccctgcagtgc
tacggtgttggacctttaggcgacttgaactgctcatgggagcctcttggggacctggga
acaccctccatgctgcacctgcagagccagaagtatcattccaacagaacctggactgtc
gcagtgcctacagggcagagctgggtggccatcccacgggaacagttcacgacatctgat
gaactccttgtctggggggcagaggcgggccggcctctgtggcccccagtcttcgtgaac
ctggaaacacaaatgaagccagaagccccccaactggaccctgacgtggacttttcagag
gattaccccatggaggccactgtccaatggtccccacctgtgtggccaccccataaggtc
ctggtctgccagttccactaccgaagatgccagcagatatcctggaccctgctggaacca
gaactaaggtccatacccctgacccctgttgagatccaggacctagagctggccactggc
tatgaggtgtctggccgctgccgaatggagaaagaagaggatctgtggggcgagtggagc
cccattctgtccttccagactctgccctctgctccaaaagatgtttggatatcaggggac
gtctgtggtacacaaggtgggcagaaatccctgcttctgtggaaggccctggggcactgt
gtgcaggtgagctatagagtctggttccaggttaaaggtcaggagctgatcccccgggag
actccctgctgtagctcctccatcccagcccaggcagagtgggctgcagtgtctgcagtc
aacgccacaagctgggagcctctcacgaacctttctctcgtctgcttgggttcaggctct
gccccccgaggtgtggtggttagcagcattgctgggagcacagagctgctggtgacttgg
caacaggggtctggggagccgcaggagcatgtggtggactgggctcgagacggggagccc
ctagagaacctcagctgggtccggcttccccccgggaacctcagtgctctgttgccaggg
aattttgaaggaggggtcccctaccgaatcacagtgacggccgtctctcctgagggtttg
taccctgccccctcagtatggaggttcagagaggaactagtacctttagtggggccagcg
ctttggcgactcgaggatgctcccccagggacccctgtcatagcgtggggagaggtccca
agacaccaacttcgaggccacctcacccactacaccttgtgcacacagagtgggaccagg
ccttctgtctgcatgaatgtgagtggcagcacccagaaaatcaccctgcccaaccttccc
tggggtccctgtgagctgtggatgatggcgtccaccatcgcaggacagggcccacctggt
cccaccctccggcttcacctaccagataacaccctaaagttgaaaattctgccaggtttc
cttctcctgtggggcttgcttctgacaggctgtggcatgagcctggccacctctggaagg
tgcctccacttgcggcacaagatactgccccgttgggtctgggagaaggtccctgatcct
gccaacagcaattccagccagccccacatagaggaggtgccccaggcccagccccccggg
gacttgcccaccctggaagtagaggagatggagccactagcagttatagagtccccccag
gcctactcccagcttgattctggatatgagaaacattttctgcccacacctgaggagctg
ggccttctgggacccccatccccaggccccaggttctggcctgaactgatcccaggccag
gagnaggggtgctcatttgacagctga

KEGG   Miniopterus natalensis: 107544754
Entry
107544754         CDS       T05883                                 

Name
(RefSeq) interleukin-4 receptor subunit alpha-like
  KO
K05071  interleukin 4 receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna05200  Pathways in cancer
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107544754
   04151 PI3K-Akt signaling pathway
    107544754
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107544754
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107544754
   04658 Th1 and Th2 cell differentiation
    107544754
   04659 Th17 cell differentiation
    107544754
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544754
  09163 Immune disease
   05321 Inflammatory bowel disease
    107544754
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107544754
   04090 CD molecules [BR:mna04090]
    107544754
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107544754
CD molecules [BR:mna04090]
 Proteins
  107544754
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 107544754
NCBI-ProteinID: XP_016078148
LinkDB
Position
Unknown
AA seq 816 aa
MEWLGSRLLFPVSCLILVWAAVSGSVQVQLRPTCFSDYLSTSACEWRMGGPTNCSAELRL
TYQLDFPDSENLTCVPENRDSMVCLCHMLMDDVASVDIYQLDLWAGPQQLWSGTFRPSEH
VKPRAPGNLTVDDSISGMWQLTWSSPYPSESFLHSELSYLVNISSEDDPTEFIVYNVTYM
EPTLRFPASTLKPGASYSARVRAWAQSYNSTWSEWSPSVKWLNYYTWPWEQRLPLTVSIA
CIVILVICLPCYFGIVKIKKEWWDQIPNPAHSPLVAIVIQESQASLWGKRSGGQEPANCP
PWKTCLAKLLPCLLEHGVGKDDSSSRAARSGPVQGPGGPAWHPVEVSRTVLWPESISVVK
CVELLEAAVESEEEAGESRGSLCPSPESSGGGFQEGRAGIAARLAESLFLDLLGGEDGGF
CPPGFGEPCPLPPSGSVSAQMPWAEVPSEEPQEASLQEGKQPPGPEPTPPATLTQSPDCP
AGTELPAAGITDNPAYRSFGTLPSQSSGPGELDSDPQLAQYLGDGDPHILSAPQPSEPPT
ALQPEPETWEQALRRSVLQHRAATAPASAPTGGYRQFVPAVKQGCAQGSAAEGFGPSGEA
GYKAFSSPLPSGAICPGTSGVEASSGEGCYRPFQSLTSGFPGVPTSVPLFTFGLDMEPPH
SPQNSLLPSSSPECLGLEPVAKGEDSQKHPLSLEQATDPLRDDLGSGIVYSALNCHLCGH
LKQRHGQEECDEAHIVATPCCGCCCGDRSEPPANPLSGGVPLEVSLPPASLVPLGVSEEG
KYSLFFQPGPSNAQSSSQTPQMVATLSTGPTRISAS
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggagtggcttggctctaggctcctgttccctgtgagctgcctgatcctggtgtgggcg
gcagtctctgggagtgttcaggtccagcttcggcccacctgcttctccgactacctcagc
acctccgcctgtgagtggaggatgggcggccccaccaactgcagcgccgagctccgcctg
acctaccagctggactttccggactccgaaaaccttacgtgcgttcctgagaacagggat
agcatggtatgcctgtgccacatgttgatggacgacgtggccagtgtggacatctaccag
ctggacctgtgggctgggccacagcagttgtggagtggcaccttcaggcccagtgagcat
gtgaaacccagggcccctggaaacctcacggttgatgacagcatctctggcatgtggcag
ctgacctggagcagcccatacccttccgagagtttcctgcactccgagctctcctatcta
gtcaacatttcaagtgaagatgaccccacggagttcatagtctacaatgtgacctacatg
gagcccaccctccgcttcccagccagcaccttaaagcccggggcttcctacagtgcacgg
gtgagggcctgggcccagagctacaacagcacgtggagtgagtggagccccagcgtcaag
tggcttaactactacacgtggccctgggagcaacgcctcccactcaccgtcagtatcgcc
tgcattgtcatcctggtcatctgcctgccctgctatttcggcattgtcaagattaagaaa
gaatggtgggaccaaattcccaacccagcccacagccccctcgtggctattgtcatccag
gagtctcaggcgtcactgtggggaaagaggtccggaggccaggaaccagccaactgccca
ccctggaagacttgtctggctaagctcctgccctgtttgctggagcatggagtgggcaag
gatgacagttcctccagggctgcgaggagcgggcctgtccagggtcctggaggaccagcg
tggcaccctgtggaggtcagcaggacggtcctctggccagagagcatcagcgtggtgaag
tgcgtggagctgttagaggccgcagtggagagtgaggaggaagctggcgaaagtagaggg
agcctctgcccctctcctgagagcagcgggggcggcttccaggagggcagggcgggcatc
gcggcccggctggcagagagcctgttcctggaccttcttgggggtgaggatggcggcttt
tgcccgccgggcttcggggagccctgccctcttccaccttcaggaagtgtgagtgcgcaa
atgccttgggctgaggtaccaagtgaggagccccaggaggcatcacttcaggaggggaag
cagcctcctggcccagagccaacccctccagccactctgacgcagagcccagactgcccg
gctggcacggagctgcccgctgccggcatcacagacaaccccgcttaccgcagcttcggc
accctgccgagccagtcctcgggtcctggagagcttgactcagacccacagctggcccag
tacctgggcgatggggaccctcacatcctctctgctccccagccctctgagccgcccact
gcactccagcctgagccagaaacctgggagcaggccctccgccggagcgtcctgcagcac
agggcagccacagcccccgcctcggcccccaccggcggctacaggcagttcgtgcccgcg
gtgaagcagggctgtgcccagggcagtgcagcggagggcttcggcccttctggagaggct
gggtacaaggccttctccagcccgctccccagcggtgccatctgcccagggacatctggg
gttgaggccagcagtggggagggatgctacaggcccttccagagcctcacttctggcttt
cctggggttcccacctcagtccccctgttcacctttggactggacatggagccacctcac
agccctcagaactcactcctccccagcagctccccagagtgcctcggtctggagccagtg
gcaaagggagaggacagccagaaacacccactctccctggagcaggccacagaccccctc
agggatgacctgggcagtggcatcgtctactcagccctcaactgccacctgtgtggccac
ctgaagcaacgtcacggccaggaggagtgtgacgaggcccacattgtggccaccccctgc
tgtggctgctgttgtggagacaggtccgagcccccagcaaaccccctgtcaggtggggtt
ccactggaggtcagcctccctccggcctccctggtacccttgggtgtctcagaggagggc
aagtactctctgttcttccagcctggccccagcaatgctcagagctcaagccagaccccc
caaatggtggccacgctctccacagggcccacacgcataagtgcttcctag

KEGG   Miniopterus natalensis: 107545002
Entry
107545002         CDS       T05883                                 

Symbol
IL11RA
Name
(RefSeq) interleukin-11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107545002 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107545002 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107545002 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107545002 (IL11RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107545002 (IL11RA)
SSDB
Motif
Pfam: ig Ig_3 EpoR_lig-bind Ig_2
Other DBs
NCBI-GeneID: 107545002
NCBI-ProteinID: XP_016078503
LinkDB
Position
Unknown
AA seq 422 aa
MSSSCSGLSRVLVAVATALVSASSSCPQAWGPPGVQYGQPGRSMTLCCPGVTAGAPVSWF
RDGETRLLQGPDSGLGHELVLARADSTDEGTYICRTLDGALGGMVTLQLGYPPARPVVSC
RAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGQRMSPSTGPWPCPQDPPGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLQVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPVQHPAWSMVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSSGPLPKEIPAGGQPHTQLEEEPQADSSAPPRPSLLPDLQPLVHR
DPLEQVAVLASLGIFSFLGLAAGALALGLWLRLRPDGKDEPQKSGFLAPMIPVDKLPGAP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcttggtggctgtggctacagccctggtg
tctgcttcctcttcctgcccccaggcctggggacccccaggggtccaatatgggcagcct
ggaaggtccatgacgctgtgttgccctggagtgactgctggggcccctgtctcctggttt
cgggatggggagacaaggctgctccagggacctgactctggactagggcatgaactggtc
ctagcccgggcagacagcactgacgagggtacctacatctgccggactctggatggtgca
cttgggggcatggtgactctgcagctgggctaccccccagcccgccctgttgtctcctgc
cgagcagctgattatgagaatttctcctgcacttggagtcccagccaggtcagcggttta
cccacccgctaccttacttcctacaggaagaagacagtaccaggagctgatggccagagg
atgagtccatctacagggccctggccatgcccacaggaccccccaggggctgcccgctgt
gtggtccatggggcagagttctggagccagtatcggatcaatgtgactgaggtgaacccc
ctgggggccagcacacgcctactggatgtgagcttgcagagcatcttgcgtcctgaccca
ccccaggggctgcaggtagagtcagtacctggctacccccgccgcctacgtgccagctgg
acctaccctgcatcctggccccgccagccccacttcctgctcaagttccggctgcagtac
cgtccagtgcagcatcccgcttggtccatggtggagccggctggattggaggaggtgatc
acagacgctgtggctgggctgccccatgctgtgcgggtcagtgccagggactttctcgat
gctggtacctggagcgcctggagtccagaggcctgggggactccaagctctgggccctta
ccaaaggagataccagctgggggtcagccacacacgcagctggaggaggagcctcaggcg
gacagctctgctcccccaaggccctccctcctgccagacctacagccacttgtccacagg
gaccccctggagcaggtggctgtgttagcatctttgggaatcttctctttcctgggactg
gcagctggggctctggcactgggcctctggctgaggctgagaccagatgggaaggatgaa
ccccaaaagtctgggttcttggccccgatgattccagtggacaagcttccaggagctcca
aacctatag

KEGG   Miniopterus natalensis: 107545016
Entry
107545016         CDS       T05883                                 

Symbol
CNTFR
Name
(RefSeq) ciliary neurotrophic factor receptor subunit alpha isoform X1
  KO
K05059  ciliary neurotrophic factor receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107545016 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107545016 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107545016 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107545016 (CNTFR)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107545016 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Receptors
  107545016 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 ig Ig_5 MAGI_u5
Other DBs
NCBI-GeneID: 107545016
NCBI-ProteinID: XP_016078523
LinkDB
Position
Unknown
AA seq 372 aa
MAVPVPWACCAVLAAATAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLTPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLHHQVILHVGLPPREPVLSCRSNT
YPKGFYCSWHLPAPTYIPNTFNVTVMHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPDSFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGRPSAPFLISVPVTLAL
AAAAATANSLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggccgttcctgtcccatgggcctgctgtgctgtgcttgctgccgctactgccgttgtc
tacgcccagagacacagtcctcaggaggcaccccacgtgcagtacgagcgcctgggctca
gacgtgactttgccatgtgggacagccaactgggatgcagctgtgacgtggcgggtaaac
gggacagacctgacccctgacctgctcaatggctctcagctcgtgctccgtggcctggaa
ctgggccacagtggcctctacgcctgcttccatcgtgactcctggcacctgcaccaccaa
gtcattctacatgtgggcttgccaccacgggagcccgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgcctgcccccacctacatccccaacacc
ttcaatgtgactgtgatgcacggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacatccgctacatgcacctgttctccaccatcaagtacaaggtctcg
ataagtgtcagcaatgccctgggccacaacgccacagctatcaccttcgacgagttcacc
attgtgaagcctgatcctccagaaaacgtggtagcccggccggtgcccagcaaccctcgc
cggctagaggtgacatggcagactccctcaacctggcccgaccctgactcctttcctctc
aagttctttctgcgctaccgaccccttatcctggatcagtggcagcatgtggagctgtcc
gatggcacagcacacaccatcacggatgcctatgctgggaaggagtacatcatccaggtg
gcggccaaggacaatgagattgggacatggagcgactggagcgtggctgcccatgccaca
ccctggactgaggagccgcgacacctcaccacagaggcacaggctcctgagaccacgacc
agcaccaccagctcactggcacccccgcccaccacgaagatctgtgaccctggggagctg
ggcagcggcggaagaccctcagcacccttcttgatcagtgtccctgtcactttggccctg
gctgccgctgctgccaccgccaacagtctcctgatctga

KEGG   Miniopterus natalensis: 107545294
Entry
107545294         CDS       T05883                                 

Symbol
IL2RB
Name
(RefSeq) interleukin-2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04144  Endocytosis
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107545294 (IL2RB)
   04151 PI3K-Akt signaling pathway
    107545294 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107545294 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107545294 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107545294 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107545294 (IL2RB)
   04659 Th17 cell differentiation
    107545294 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545294 (IL2RB)
   05202 Transcriptional misregulation in cancer
    107545294 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545294 (IL2RB)
   05162 Measles
    107545294 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107545294 (IL2RB)
   04090 CD molecules [BR:mna04090]
    107545294 (IL2RB)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107545294 (IL2RB)
CD molecules [BR:mna04090]
 Proteins
  107545294 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 107545294
NCBI-ProteinID: XP_016078832
LinkDB
Position
Unknown
AA seq 561 aa
MAAAALSRCPLLVFFLLLAIPRESAAENDTSKLTCFYNSRANISCVWSRDGGLLPTTCLV
QAQPDQRPWNKSCELFPVGPASWSCNLILGSPPYSQQLTSADTLKMSVMCLEGERWRRVI
TQDFKPFDNLRLMAPDSLQVTHIGTHRCNLTWSVPQASHYLERYLEFEARTRSPGGSWEE
ATVLTLKQNQQWICLETLSPGTPYEFQVRVRAHRGNLMTWSPWSQPLAFMTRSEPAPSLG
HIVVGLCGAFGFVMLVYLLASCRYLGPWLKKVLKCHIPDPSGFFSQLSSEHGGDFQKWLS
SPFPSSSFSPSGPAPEISPLEVLDRDTKATQLLLLQQDKGLSPSLETSGHSLTSCFTNQG
YFFFHLPDALEIEACQVYFTYDPCAAELEEGGPAAPEGSLLPPLPPPPGEDDAYCTFPPR
DDLLLFSPNLLGGPSPPNTALGGTGACDERLPPSLQEGVPNDWVPGALGPPTPGATDLVD
FQSPLEHALGGAGGEVPGPGPGPGPGPGPGPGPGPGKGAAFPWASPPGQCQVRAPTSCLT
LNTDAYLSLQELQDQDPTHLV
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcggctgctgctctgtcccgctgtcccctcctggtcttcttcctgctcctggccatc
cctcgggagtctgcagcagagaacgacacttccaagctcacgtgcttctacaactcgaga
gccaacatctcctgtgtctggagccgggatgggggcctgctgcccacaacctgcctcgtc
caagcccagcctgatcagcggccctggaacaaatcctgtgagctgttcccagtggggccg
gcatcgtggtcctgcaacctgatccttgggtcccccccatattctcagcaactgacctca
gcagacaccctcaagatgagtgtgatgtgcctcgaaggggagaggtggaggagggtgatc
acgcaggacttcaagccctttgacaaccttcgcctgatggcccctgactccctccaagtc
acccacatagggacccacagatgcaacttaacctggagcgtcccccaggcctcccactac
cttgaaagatacctggagtttgaggcccggacgaggtccccaggcggcagctgggaggag
gccaccgtgctgaccctcaagcagaaccagcaatggatctgcctggagacgctatctcca
ggcaccccgtatgagttccaggtgcgggtcagggcccaccgaggcaacctcatgacttgg
agcccctggagccagcccctggccttcatgacgaggagtgaaccagcgccttcactgggc
catatcgtcgtgggcctctgcggtgcctttggcttcgtcatgttagtctacctgctggcc
agctgccggtaccttgggccctggttgaagaaggttctgaagtgtcacatcccagacccc
tcggggttcttttcccagctgagctcagagcatggaggagatttccagaagtggctctcc
tcgcccttcccttcctcctccttcagccccagcggcccggcacccgagatctccccgctg
gaggtgctggacagggacaccaaggccacacagctgctcctgctgcagcaggacaaaggg
ctctcgccctcccttgagaccagcggccactcactgaccagctgcttcaccaaccaaggc
tacttcttcttccacctcccggacgcgctggagatcgaggcctgccaggtgtacttcacc
tacgacccctgcgctgcggagctggaagagggggggcctgcagcgcctgaggggtctctc
ctcccacccctgccgcctccgccaggggaggatgatgcctactgcaccttcccccccagg
gatgacctgctgctcttctcccccaatctgctcggtggcccaagccccccaaacactgcc
ctaggaggcactggggcttgtgatgagaggctgcccccctccctgcaggaaggagtcccc
aatgactgggtccctggggccctggggcctcctacccctggagccactgacctggtggat
ttccagtcacccctggagcatgcactgggaggagcgggaggggaggtgcctggccctggc
cctggccctggccctggccctggccctggccctggccctggccctgggaagggggccgcc
ttcccctgggccagccctcctgggcaatgccaggtcagggctcccacctcctgtctgacc
ctgaacactgacgcttacctgtccctccaagagcttcaagatcaggacccaactcacttg
gtgtag

KEGG   Miniopterus natalensis: 107545322
Entry
107545322         CDS       T05883                                 

Symbol
CSF2RB
Name
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04210  Apoptosis
mna04630  JAK-STAT signaling pathway
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107545322 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107545322 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107545322 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545322 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107545322 (CSF2RB)
   04090 CD molecules [BR:mna04090]
    107545322 (CSF2RB)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL3 receptor family
   107545322 (CSF2RB)
CD molecules [BR:mna04090]
 Proteins
  107545322 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind IL4Ra_N Tissue_fac EpoR_lig-bind fn3 IL2RB_N1
Other DBs
NCBI-GeneID: 107545322
NCBI-ProteinID: XP_016078884
LinkDB
Position
Unknown
AA seq 885 aa
MALAWCLLPIALLTLSQESSMAEAQGTVPLQTLSCHNDYTSRIICRWADTEDAQQVINVT
LHRRLNKSPPQPVSCDLSDDMPWSDCPSPRCVPRKCVIPYKLFVIADQDSFSFQPDRPLG
TQLTVVLTQHVQPPAPKDLHVSAAGDRFLLTWNVTLEGSQSQWLSNLEFEVFYRRLQDSW
EDASTLYSAIPQADLGPEHLMPSSTYVARVRTRLGPGSGLSGRPSQWSSEVLWDSQPGDK
AQPQNLQCFFDGGTELSCSWEVRLEVTSSLSFTLFYKSSPSAGEQECHPVLKEASGPYVR
HRCQVPVVDPWNHSQYIVSVRPKEEEKFIKSSDHIQMAPPTLNLTKGRGGYILRWEVEAM
LSTYIEYTFEVQYKKDTDSWEESKTEPLQNTYIMSLPPLESSTRYQARVRVKPYNSYSGI
WSEWSEESSWDTEWVLPTWGLAIVLVFITLALLLALRFCGTYGYRLNQKWKEKIPNPSKS
QLFQNGSAGLWLPSSVSAITSRSSSHKGPWDSFFPGLEGVSPVNCMHSEVSPLTIEDPKN
AHDSPSEPNTTPAASDLPTDPPPSPLPCLTAPSSRLEGQASGFDFNGPYLGPPHSLSLPD
LVGQEELPGMGVSQKPLPPGSLEYLCLPEGEQMQLVPLAQVAGQRQARGVERRPSPGAKE
SPSLESGAGPVPPAPGQMVGGQGTKDSPAAPSAASGGSEDSTPASGFVSTADLARTLPTG
ALSAPRVLPLSLPAGQNQGLCPGQAPGPPGAPAPVRSEFDSYVELPPTMSPKSPLVGSSQ
VLSPREPRGEVSPVSPCPGGLLVLQQVGDYCFLPGVGSGSLSPQRKSSSPGPFPELRDLD
QGLQAKKPPSQGLPQVPAIQLFKALKQQDYLSLPPWDVSRPGEVC
NT seq 2658 nt   +upstreamnt  +downstreamnt
atggcgctggcctggtgcctgctccccatcgccctgctcaccctgagccaggagtccagc
atggcagaggcccaagggaccgtcccgctgcagaccctgagctgccataacgactacacc
agccgcatcatctgcaggtgggctgacaccgaggacgcccagcaggtcatcaacgtgacc
ctccaccgcaggctgaataagtcccccccgcagccagtatcctgtgatctcagtgacgac
atgccctggtccgactgcccttctccccgctgtgtgcccagaaaatgtgtcattccctac
aagctgtttgtcattgccgaccaggacagcttctcattccaaccggacaggcctctgggc
acccagctcaccgttgttctgacccagcatgtgcagccccccgcacctaaggacctccac
gtcagtgctgccggagaccggttcctgctgacctggaatgtgactctcgagggttcccag
agccagtggctatcaaacctggagttcgaggtgttctacaggcggcttcaggactcctgg
gaggatgcctccaccctctactccgccatcccgcaggccgacctggggccagagcacctc
atgcccagcagcacctatgtggcccgagtgcgcacccggctgggcccaggctcagggctc
tcgggccggcccagccaatggagctcggaggtcctttgggactcccagccaggggacaag
gcccagccccagaacctccagtgcttctttgatgggggcactgagctcagctgctcctgg
gaagtgaggctcgaggtgaccagctctctctccttcaccctcttctacaagtccagcccc
agcgcaggggagcaagaatgccacccggtgctgaaggaggccagcggcccctatgtccga
caccggtgccaggttcccgtggtcgatccctggaaccacagccagtacatcgtctctgtt
cggccaaaggaggaagagaagtttataaagagctcagaccacatccagatggcgcccccg
acactcaacttgaccaagggcagaggcggctacatcctgcgctgggaagtagaggcgatg
ctctccacatacatagagtacaccttcgaggtccagtacaagaaagacacagactcgtgg
gaggagagcaagacagagcccctccagaacacctacatcatgtcgctgccccctctggag
tcctccaccaggtaccaggcgagagtgagggtcaagccctacaacagctacagcgggatc
tggagcgagtggagtgaggagagctcctgggacacggagtgggtgctgcccacgtggggc
ctggccattgtcctagtcttcatcaccctcgccttactcctggccctgcgcttctgtggc
acctatgggtacaggctgaaccagaagtggaaggagaaaatccccaaccccagtaagagc
cagctgttccagaatgggagtgcagggctctggctccccagcagcgtgtctgccatcacc
agcaggagctcttcacacaaagggccgtgggacagcttcttccctgggctggagggggtg
tcccctgtaaattgcatgcacagcgaagtgtcacctctcaccatagaggaccctaaaaat
gcccatgactcaccatctgagcctaacacgactccggctgcctcggacctgcccacggac
ccgcccccgagtcccttgccctgcctgacagccccgtccagcaggcttgagggccaggct
tccggcttcgacttcaatggcccctacctggggccaccccacagcctctccctgcctgac
cttgtagggcaggaggagctcccagggatgggtgtgagccagaagcccctgcccccaggg
tccctggagtacctgtgcctgcctgaaggggagcagatgcagctggtcccattggcccag
gtggcaggacagcgccaggccaggggtgtggagaggagaccttccccgggggccaaggag
agcccctctctggagtcaggggcaggccccgtccctcctgcacctgggcagatggtgggg
ggtcagggcacgaaggatagccctgcagctccgtccgctgcgtctgggggctctgaggac
agcaccccggcttctggtttcgtcagcactgcagacctggcgcgcaccttacccacaggg
gccctgtccgcccctcgggttcttcctctgagcctccctgcaggccagaaccagggcctc
tgtcccggtcaggctcctgggccccctggagccccagccccggtgaggtcagagtttgac
agctatgtggagctccctcccaccatgtcccctaagtcccctctggtgggcagcagccag
gtcctgagcccaagggagccccggggagaggtgagcccggtctctccatgccccgggggg
ctcctggtcctgcagcaggtgggtgactattgctttcttcctggcgtggggtctggctcc
ctctcaccccagagaaagtcctcttctcccggaccctttcctgagctcagggacctggac
cagggcctccaggccaagaagcctcccagccagggccttccccaggtgccggccattcag
ctcttcaaagccctgaagcagcaggactacctgtcactgccgccctgggatgtcagcagg
cctggggaagtgtgctga

KEGG   Miniopterus natalensis: 107545625
Entry
107545625         CDS       T05883                                 

Symbol
GHR
Name
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04080  Neuroactive ligand-receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107545625 (GHR)
   04151 PI3K-Akt signaling pathway
    107545625 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107545625 (GHR)
   04060 Cytokine-cytokine receptor interaction
    107545625 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107545625 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107545625 (GHR)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  Prolactin receptor family
   107545625 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 DUF3149
Other DBs
NCBI-GeneID: 107545625
NCBI-ProteinID: XP_016079232
LinkDB
Position
Unknown
AA seq 636 aa
MDLWKLLLTLAVAGSSDAFSGSEAIPAALDQASQNLQRVHPGPATNSSGTPRFTKCRSPE
LETFSCHWTDGVHHGFGSPGHVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNASYTS
IWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPTGLNWTLLNISLTGIHADIQVRWEPPSN
ADVQKGWIVLEYELQYRETNETQWKMMDPVLSTSVPVYSLRLDKQYEVRVRSRQRNSDKY
GEFSEVLVVSLPQMSPLACDEDFRFPWFLIIIFGMFGLIVIFLLMFSKQERIKMLILPPV
PVPKIKGIDPGLFKEGKLEEVNTILAVHDSCKPEFCNDDSWVEFIELDIDDPDEKTDGSD
TDRLLRDDHQKLLNILGAKDDDSGRTSCYDPDILEADFQASDLGDGALEAAQPQRLKGEA
DLLCLDAKNRTDPPPRAAAPAAQEPGVGLAQEDKPRPLFGETESTHQAAHPQLNNPSSVA
NIDFYAQVSDITPAGSVVLSPGQKHKAGTAPCAAHPEVGAPCQANFLTDSAYFCEADATK
CIAGAPPGELGARGAPSFNQEDTYITTESLTTTARRPGAAGGAPGSQTPVPDYTSIHIVQ
SPQGLILNATASPRPDKEFLSACGYVSADQLDNIMP
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggatctctggaagttgctattgaccttggcagtggctggctccagtgatgctttttct
gggagtgaagccataccagctgccctcgaccaagcatcccagaacctacagagagttcat
cctggcccagcgacaaactcttctgggacgcccaggttcaccaagtgccgttcgcctgaa
ctggagacgttttcatgccactggacagacggggttcatcacggtttcgggagcccggga
cacgtacagctgttctacattagaaggaacactcaagaatggactcaggaatggaaagaa
tgccctgactatgtctctgcgggagaaaacagctgttacttcaatgcgtcgtatacctcc
atctggataccctactgtatcaaactcactagcaacggcggtaccgtggatcaaaagtgc
ttctctgtcgaggaaatagtacaaccagatccacccacgggcctcaactggaccttactg
aacatcagcctgaccgggatccacgcggatatccaagtgcgatgggagccgccatccaat
gcagatgttcagaaagggtggatcgtcctggagtacgagctgcaatacagagagaccaac
gagacccagtggaaaatgatggaccctgtgctgtcaacatccgtcccagtgtactcgctg
aggctcgacaaacagtacgaggttcgcgtgcgctccaggcagcggaactcggacaaatac
ggcgagttcagcgaggtcctcgtcgtctcgctcccccagatgagcccgctggcgtgtgac
gaagatttccggtttccgtggttcttaattattatctttggaatgtttgggctgatcgtg
atatttttactcatgttttctaaacaggaaaggattaagatgctgattctgcccccagtt
ccagttccaaagattaaaggaatcgatccaggcctcttcaaggaagggaaactggaggag
gtgaacacaatcttagccgttcacgacagctgcaagcctgaattctgcaacgacgactcc
tgggttgagttcattgagctggatatcgacgaccctgatgagaagacggacgggtccgac
acagacaggcttctccgcgacgaccatcagaaattacttaacatccttggggcgaaggat
gacgactcgggacgtaccagctgctacgaccctgacatcctggaggccgacttccaggcc
agtgacctgggcgacggtgccttggaggccgcgcagccccagaggttaaagggggaagca
gatctcttgtgccttgacgcgaagaaccggaccgacccgccgccgagggctgcggcccct
gccgcgcaggagcccggtgttggcctcgcccaggaagacaaaccaagaccactttttggg
gaaactgagtcaacccaccaagccgcccatcctcagctgaacaatccgagttcagtggca
aacattgacttttacgcccaggtaagcgacatcacgccagcagggagtgtggtcctctcc
ccgggccaaaagcataaggcagggacagccccgtgcgccgcgcatcccgaggtgggcgcc
ccctgccaagcaaacttcctcacggacagcgcctacttctgcgaggcggacgccaccaag
tgcatcgccggggccccgcccggggagctgggggcgcggggggcgccaagctttaaccag
gaggacacctacatcaccacagaaagccttaccactactgctcggaggcctggggcggca
ggaggggcgccgggctcccagacgcccgtcccagactacacctccatccacatagtccag
tccccgcagggcctgatcctcaacgccaccgcgtcgccccggcccgacaaggagttcctc
tcggcctgtggctacgtgagcgccgaccagctggacaacatcatgccctag

KEGG   Miniopterus natalensis: 107545726
Entry
107545726         CDS       T05883                                 

Symbol
LIFR
Name
(RefSeq) leukemia inhibitory factor receptor isoform X1
  KO
K05058  leukemia inhibitory factor receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107545726 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107545726 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107545726 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107545726 (LIFR)
   04090 CD molecules [BR:mna04090]
    107545726 (LIFR)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107545726 (LIFR)
CD molecules [BR:mna04090]
 Proteins
  107545726 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 IL6Ra-bind Pur_ac_phosph_N TMEM154 DUF3827
Other DBs
NCBI-GeneID: 107545726
NCBI-ProteinID: XP_016079393
LinkDB
Position
Unknown
AA seq 1095 aa
MLDAASRLGRPSGMAAGGRGATSSARWSFATLALLYLLNQVHGQRRGSPRDLKCVTNNLQ
AWDCSWKAPSGAGRGALYSICFDSRFHSCYRLGKTTKIPPLTPGDYEITINSVPDFGSSI
SKFILNEKNVSFIPDAPEILSLSADFPTSTLHLKWKDRGSVFPHHLNVIWEIKILRKENM
EVVKLETFSTTLNGEDTVHHWSWASDMPLECATHSVGIRCYVDDPHFSGRKEWSDWSPLK
NVSWSARSQSKVFPQDKVILVGSDITFCCVTQEKVSSAQIGYTKCPLVHLDGENVAIHIH
NISVSENSGTNVVFTTKENIYGTVIFAGYPPDIPQKLNCETYDLKEIICTWEPGRPTALV
GPRGTSYTLFESFSGEYVKFKRVEVPVNDSYQLFFQMHPNQEMYNFTLNARNPLGHSEST
TLINVTEKVYPHTPTSIRVKDINSTAVTLSWHLPGSFAKINLLCQVEINKANSVQELRNV
TVKGVDNSNYLIAVDKLNPYTVYTFRIRCSSETFWKWSKWSNQKQYLTTEAIPSKGPDTW
REWRSDGKNLIIYWKPLPVNEANGKILFYNVSCSSDEKTQSLSEIPDPQHKAEIQLDKND
YIISVVAKNSAGASPPSRIASMEIPNDDLKIEQTVGMGNGILLTWNHDPNMTCDYVVKWC
NSSQPEPCLMDWKKVPANSTETLIESDQFRPGVRYNFFLYGCRNQGYQLLRSVIGYTEEL
APIVAPNFTVEDTSADSILVKWEDIPAEELRGFLRGYLFYFEKGERDTSKMRGLEPGRSD
VKVKNITDISQKTLRIADLQGKTSYHLVLRAYTNGGLGPEKSMFVVTKENSVGLIIAILI
PVAVAVIVGVVTSILCYRKREWVKETFYPDIPNPENCKALQFQKSTCEGNSALKTLEMNP
CTPNNVEVLETRAAGPKIEDTQIISPVAERPQERAEAEPENHVVVSYCPPVIEEEIANPG
ADEAGGTSQVVYIDVQSMYQPQAKPEEDPEAEAAPGAGYKPQMRLPVAAAVEEAAEEGDL
GKAAGYRPQATVNTWTLVSPDSPRSTDSNSEVVSFGSPCSINSRQFLIPPKDEDSPKSDG
GGWSFTNFFQNKPND
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgctggacgccgcctcacgtctcggacggccgtcggggatggcggccgggggaaggggg
gcgacttcaagcgcccgctggtccttcgcgacactcgccctcctgtatttactgaatcaa
gtacacggccagagaaggggctctccccgtgacttgaagtgtgtaaccaacaatttacaa
gcgtgggactgttcttggaaagcaccctcaggagcaggccgcggggctctttacagcatt
tgcttcgatagcaggttccattcttgttatcgattggggaaaactactaaaatcccacct
cttacacctggtgattatgaaataacgataaactctgtacctgattttggaagttctata
agtaaattcatactgaatgaaaaaaatgtgtccttcattccagacgctccggagatcttg
agtttgtctgctgatttcccaacttccacgttacacctgaagtggaaggacaggggctcc
gtttttccacatcacttaaatgtcatctgggagattaaaattctccgtaaagagaatatg
gaagtcgtgaaattggagaccttcagcaccactctgaatggagaggatacagttcaccac
tggagctgggcctcagacatgcccctggagtgtgccactcactccgtaggaattcgatgt
tacgtcgatgatcctcatttctctggtcgcaaagagtggagtgactggagccccctgaag
aacgtttcctggtctgctcgttctcagagtaaggtttttcctcaggacaaagtgatactc
gtgggctcagatatcacattttgttgtgtgactcaagaaaaagtgtcatcggcgcagatc
ggctacacaaagtgcccccttgtgcatctcgacggggagaacgtggcaatccacatccac
aacatttctgtttctgagaacagtgggacaaacgtggttttcacaacaaaggagaacatt
tatgggacagttatttttgcaggatatccacctgatattcctcagaaactgaactgtgag
acttacgatttaaaagagatcatctgcacttgggagccaggaaggccgacggcgctggtg
ggcccacgcggcaccagttacacgctgtttgaaagtttttcaggagaatatgttaaattt
aaaagagtcgaagtgcctgtaaatgacagctatcagctattcttccaaatgcatccaaat
caagaaatgtataattttactttgaatgctcgcaaccctctgggtcactcagaatcgaca
acattaattaatgtgactgagaaagtttatccccatactcctacttcgatcagagtgaag
gatattaattcaacagctgttacactttcctggcatttgccaggcagctttgcaaagatt
aatctgctgtgtcaagttgaaattaacaaagctaattcagtgcaagaattgcggaatgtc
acagtcaaaggagtggacaactcaaattatctcattgctgtggacaagttaaatccatat
actgtgtatacctttcggattcgttgttctagtgaaactttctggaagtggagcaaatgg
agcaaccaaaaacaatatttaaccacagaggccattccttcaaagggaccagatacttgg
agagagtggcgttctgatgggaaaaatctaataatatattggaagcctttgcccgttaac
gaagctaatggaaaaatactcttctataacgtgtcgtgttcgtcggacgagaaaactcag
tccctttccgagatccccgatcctcagcacaaggcggaaatacagctcgacaaaaatgac
tacatcatcagcgtggtggccaagaactcggcgggcgcctcgccaccgtccagaatagcc
agcatggaaatcccaaacgatgatctgaaaatcgagcagacggtcgggatgggaaatggg
atcctcctcacgtggaaccacgaccccaacatgacttgcgactacgtcgttaagtggtgc
aactcttctcagccagagccctgcctgatggactggaagaaggtccctgcgaacagcacc
gagaccctcatagagtccgatcagtttcgccccggcgtgaggtacaacttcttcctgtac
gggtgcagaaaccaaggctatcagttgctgcgctctgtgatcggatacacggaagagctg
gctcccatcgtcgctcccaattttaccgttgaggatacgtctgcagactcgatactagtg
aaatgggaagatattcctgcggaagagcttaggggctttctacggggatacttattctac
tttgaaaaaggagagagagacacatcgaagatgaggggtttggaaccaggtcgttccgac
gtcaaggttaagaacatcacggacatatcccagaagacactgagaatcgctgatcttcag
ggtaaaacaagttaccacctggtgttgcgggcctacacgaatggcggattgggccccgag
aagagcatgtttgtggtgaccaaggaaaactccgtgggactgataatcgccattctcatc
ccggtggcggtggctgtcatcgttggagtggtgacaagtatcctttgttaccggaagcga
gaatgggtaaaggaaaccttctacccggacatccccaatcccgagaactgcaaagccctg
cagttccagaagagcacctgtgagggaaacagcgctcttaaaacactggaaatgaatcct
tgtaccccaaataacgtggaggttctggagactcgggcagcgggtcctaaaatagaggac
acgcagatcatttccccggtggccgagcgtccgcaggagcgcgccgaggccgagcccgag
aaccacgtggtcgtgtcctactgcccccccgtcatcgaggaagaaatagcgaacccaggg
gcggatgaagccgggggcacctcgcaggtcgtttacatcgacgtgcagtccatgtaccag
ccgcaggccaagccggaggaggacccggaggccgaggccgcgccgggcgccggctacaag
ccgcagatgcgcctccccgtggcggccgccgtggaggaggcagccgaggagggcgacctg
ggtaaggccgcggggtacagaccgcaggccactgtgaacacctggaccttggtgtcccca
gactccccccgctccacggacagcaacagcgaggtggtgtccttcggaagcccttgctcc
atcaactcccggcagtttttgattccgcctaaggatgaagactctccgaaatctgacggg
ggagggtggtccttcacaaactttttccagaacaaaccaaacgattaa

KEGG   Miniopterus natalensis: 107545740
Entry
107545740         CDS       T05883                                 

Symbol
OSMR
Name
(RefSeq) oncostatin-M-specific receptor subunit beta
  KO
K05057  oncostatin M receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107545740 (OSMR)
   04151 PI3K-Akt signaling pathway
    107545740 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107545740 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107545740 (OSMR)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL6/12 receptor family
   107545740 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind LIFR_N IL6Ra-bind
Other DBs
NCBI-GeneID: 107545740
NCBI-ProteinID: XP_016079414
LinkDB
Position
Unknown
AA seq 1003 aa
MAPLAVFQATFLLVLLPLRTYQSGVLSKPSSVTPEPLSLTPEPSSVTPEPSSLTPESLKV
SINSAQQCLHLQWSVRNLTQQELKMVFQIEISRIKTSNVIWVGRYSATVERGRALHWSWG
SELPLECAAHFVRIRGMLDDTTPGPPSWSRWSSWEEADGRDSLGQGSLFLFPKDKLVEEG
SNVTVCYVARTQQNNISCILEGVLIQGKRLAPDVSVFTLNSVPFIRDTGTNMYCEANTMN
TTNTTNTTNTTNTTIIGGIVLFVAKVLEEPKDFSCETRDFKTLDCTWEPGSNTDLPKYSS
QRYTLFESFSGKKKFCEHKNSCTWQVAPDSQEMYNFTLVAENHFRKRSVNLLFNLAHRVH
PMTPYNVFLKSVRATNATVTWKVHSVGNYSTFLCQVELHGEGKVIQHNVSVRESGEYLFS
DLEPAAEYVARMRCAAANHFWKWSGWTGQNFSTLEAAPSEAPDIWRSVESMPGSCNVTLF
WKPLSKAHAHGKILNYNVVTEKLNTPSSLKLVSIPAPANGTELTLDGCSYQIQVTASNTA
GTSPASVIVISGDPGHEEVAEERVEGTEDGVPLSWKPPSGDVIGYVVDWCDRPRDSPCDL
QWKHLGPNTTSTVINSDAFRPGVRYNFRIYGISPERMAHLLERKTGYSQELAPVDTPRAA
VSNLTSHSFTLSWTGYPADAQPGFIRGYSLYLRSKAEQCHPGFKKAAVSDDLVCCKHDIN
NPEQKTFVVEKLQPEPFYEFMVTARTGAGEGPPGTFTKVTMPDQYFNVLTRIILPTVFLL
LLGTILCYMNSQWMKETCYPDIPDPYKSSVLSVLKPKENPRLAIMNVYHCVPDAIEVVNK
PEGSRIQFPGARKSLTETAATKPDYIYLLPTEGTGPCICFENLTYNQAAPDSGACGHIPA
PHNAPPGQLGLLTSPGNLLKSLKLNYMNSPGEIPAGETTLNYVSQLASPMTGDKESLPMN
SPKPAPHSEYRMQMAIPLGVASPSSDENSNLSVTLLDQGEHCR
NT seq 3012 nt   +upstreamnt  +downstreamnt
atggctcccttggcagtctttcaggcaacattcctcttggtgttgctgcccttgagaact
taccagagcggagtcttgtccaaaccttcgtcagtgacccctgaacctttatcattgacc
cctgaaccttcgtcagtgacccctgaaccttcgtcactgacccctgaatcattgaaggtt
tccatcaattccgcacagcagtgtctgcatttacagtggagtgtccgcaaccttacccag
caggaattaaagatggtttttcagatcgaaatcagcagaattaaaacatccaatgtcatc
tgggtggggaggtacagcgccacggtggagcggggccgggctctgcactggagctggggg
tccgagctccccctggaatgtgcggcgcacttcgtaagaatacggggtatgctggacgac
accacccccgggccgccgtcctggagccgctggagctcgtgggaggaagcagatgggcgg
gattcgcttggacaaggctcactgttccttttccctaaagataagctggtggaggaaggc
tccaatgtcaccgtctgctacgttgccaggacccagcagaataacatatcctgtatcttg
gaaggggtgctgatccaagggaaacgacttgctccggacgtgtccgtatttaccctgaac
agcgtccccttcattagggacacggggaccaacatgtattgtgaggcgaacaccatgaac
accacgaacaccacgaataccacgaacaccacgaacaccacgatcatagggggcatcgtc
ctctttgtcgcaaaagtgcttgaggagcccaaggacttttcttgtgagactcgggacttc
aagactttggactgtacctgggagcctgggagtaacactgacctacctaaatattcttcc
caacgttacactttatttgaatcattttctgggaaaaagaaattctgtgaacacaaaaac
tcgtgtacttggcaagtagctccagactcacaagaaatgtataacttcacactcgtggct
gaaaaccacttcaggaagaggagtgtcaatttgctttttaacctggcacatcgagttcat
ccaatgactccctataatgtattcctgaagagtgtaagggccacgaatgccaccgtgacc
tggaaggtgcactccgttgggaattattccacatttttgtgtcaggttgaactccatggt
gaaggaaaagtgatacaacacaatgtttccgtcagggagagtggcgagtacctcttcagt
gacctggaacccgccgccgagtatgtggcccggatgcgctgcgctgccgccaaccacttc
tggaaatggagcggctggaccgggcagaacttcagcacactggaggctgctccctccgag
gctcctgacatctggagaagcgtggagtcaatgccgggatcttgtaatgtcactttattc
tggaagccactatcaaaagcgcacgcccatgggaagattctgaactataacgtagttaca
gagaagctgaacacaccgtccagtttgaagctcgtttccatccctgctccggccaatggc
acagaactgacccttgacgggtgttcctaccaaatccaagtgacagccagcaacaccgcg
ggcacctctcctgcttccgtgattgtcatctccggggaccctgggcatgaagaggttgca
gaagaaagagttgagggcacagaggatggagtccctttgtcttggaaaccgccatctgga
gatgtcataggctacgttgtggactggtgtgaccgtccccgggactcaccctgtgatctg
cagtggaaacacctgggccccaataccacaagcacagtcattaactcagatgctttcaga
ccaggagtccgatacaacttcaggatttatggaatttctccagaaaggatggctcattta
ttggagcggaaaacaggatactcccaggaactggcccctgtggacaccccccgagcggcc
gtaagcaacctgacatcccactccttcacgctgagctggacgggctaccccgccgacgcc
cagcccggcttcatccgcgggtacagcctctacctgaggtccaaggcggagcagtgccac
ccggggttcaaaaaggctgccgtttcagatgacttggtctgttgcaagcatgacatcaac
aacccggaacagaagacgttcgtggtggagaagctgcagccggagcccttctacgagttc
atggtcacggcgcgcacgggggctggcgagggccctcctggcaccttcaccaaggtcacc
atgcccgaccagtacttcaacgtactgacccgcatcatactccccaccgtcttcctcctc
ctgctcggcaccatcctgtgctacatgaacagtcagtggatgaaggagacctgctaccct
gacatcccagacccctacaagagcagcgtcctgtcagtactgaagcccaaggagaaccct
cgcctggcaataatgaatgtctaccactgtgttcccgatgccatcgaggttgtcaacaag
cccgaggggagcaggatccagttcccgggcgctcggaagtcgctcacggaaaccgcagct
acgaagcccgactacatttacctcctccccacggagggcacgggcccctgcatctgtttc
gagaacctgacctacaaccaggcggctcctgactcgggtgcctgtggccacatcccagca
ccccacaatgccccaccagggcagctgggactgctgacttcacctggaaacttactgaag
tcactaaaactaaactacatgaactccccgggggagatcccagccggagagactactttg
aattacgtgtcgcagttggcttcacccatgactggagacaaggagagtctcccaatgaac
tcccccaagccagcaccccattccgagtatagaatgcaaatggccatacccctgggtgtt
gcctccccttcctcggatgagaatagcaatctctcagttacccttttagatcagggcgaa
cactgccgctaa

KEGG   Miniopterus natalensis: 107546079
Entry
107546079         CDS       T05883                                 

Symbol
IL20RB
Name
(RefSeq) interleukin-20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04061  Viral protein interaction with cytokine and cytokine receptor
mna04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107546079 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107546079 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107546079 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107546079 (IL20RB)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL10/28 receptor family
   107546079 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 107546079
NCBI-ProteinID: XP_016079816
LinkDB
Position
Unknown
AA seq 294 aa
MWFFYTVIPCLLIHGVALLPAPQNLSVQSTNMKHLLMWSPVIMAGETIHYSVEYQGEYES
LYMGDLWIPSSRCSPTQVPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNST
ILTPPGMEVTKDGFHLVIKLEDLGPQFEFLVAYWRREPGAKEHIKVVRSRGIPVHLETME
PGAVYCVKAQTFVKVIDRHSAFSQAECVKVQEETLPLALALFAFVGFMLILVVVPLSIWK
MGRLLRYSCCPVVGLPDTLKITNSPQKLVSCRKEEVDACATTMLPSEELFRTWI
NT seq 885 nt   +upstreamnt  +downstreamnt
atgtggtttttctacaccgtgattccatgtttgctcatacatggagttgcccttctgcct
gcccctcagaacctctctgtacaatcaactaacatgaagcatctcttgatgtggagccca
gtgatcatggctggagaaacaatacactattctgttgagtaccagggagagtatgagagc
ctgtacatgggcgacttgtggatccccagcagcaggtgctcacctacccaagttcccgag
tgtgacgttactgatgacatcactgccaccgtgccgtacaacctccgtgtcagagccacc
ctaggctcacagacctcagcctggagcatcctgaaacacccctttaatcgaaactcaacc
atcctaaccccgcctggaatggaggtcaccaaggatggcttccacctggttattaaactg
gaagacctggggccccagtttgagttcctcgtggcttactggaggagggagcctggtgct
aaggaacacatcaaagtggtgaggagcaggggcattccggtgcacctggaaaccatggag
ccaggggcggtgtactgtgtgaaggcccagacattcgtgaaggtcatcgacaggcacagc
gccttcagccaggccgaatgtgtcaaggtgcaagaagagaccctccccctggctctggcc
ctgttcgcatttgttggcttcatgctgatcctcgtggtggtgccgctctccatctggaag
atgggccggctgctccggtactcctgttgccccgtggtggggctcccggacaccttgaaa
atcaccaattcaccccagaagttagtcagctgcagaaaggaggaggtagatgcctgtgcc
acgaccatgctgccttctgaggaactcttcaggacctggatctag

KEGG   Miniopterus natalensis: 107546187
Entry
107546187         CDS       T05883                                 

Symbol
PRLR
Name
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04080  Neuroactive ligand-receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107546187 (PRLR)
   04151 PI3K-Akt signaling pathway
    107546187 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107546187 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    107546187 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    107546187 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107546187 (PRLR)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  Prolactin receptor family
   107546187 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 107546187
NCBI-ProteinID: XP_016079980
LinkDB
Position
Unknown
AA seq 623 aa
MKGNVAPTLVAILLLFLNTNLLNGQSPPGKPEISKCRSSEKETFTCWWKPGPDGGLPTNY
TLTYHKEGDSLTYECPDYKTGGPNSCYFNKKHTSIWTIYIITIKATNQMGSSSSDPRYVD
VTYIVEPDPPMNLTLEIKQPEDQKPYLWIKWLPPTQVDIRSGWLTLQYEIRLKPEKAAEW
EIHFAGQQTQFKILSLYPGQKYLVQVRCKPDHGFWSEWGPEGSIQIPDDSTNTDTTVWIF
VAVLSVVICLIIVWAVALKGYSMVTCVFPPVPGPKIKGFDIHLLEKGKSEELLSALGCQD
FPSDCEDLLVELLEVVDSENQQLMPGHSKEHPDQGTKPKHLDADTDSGQGSCDSPSLLSN
NCEEPQENPSTVHIPEGIEMPENPEGNGTHTWDPQSTSSEGRIPYFYADGPKCSTWPSSQ
LPSQHNTRSSYHNIADVCKLAMGTAGALATLLDKTDKHALPSLQTTKTGEEETAAEQREV
ESLQPKTDPDTPWLLPQEKTSFISAKPLDYVEIHKINKDGELSLLPKHKENSNQTEKVGA
PRTSKEYAKVSRVMDNNILVLVQDPPAQDLALLEEPAEEAPASLQQNQEEKDLASFTATP
SNCRLQLGGLDYLDPTYLKHSFQ
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgaagggaaatgtggcgcccacattggttgccattttgctactttttctcaacaccaat
cttctgaacggacagtcacctcctgggaaacctgagatctctaaatgccgctcttctgaa
aaggaaaccttcacgtgctggtggaagcctgggccggatggaggactccccaccaactac
acgctgacctaccacaaggaaggagattcgctcacctacgaatgtccagactacaaaacc
ggtggccccaactcctgttactttaacaagaagcacacctccatctggacaatatacatc
atcacaataaaggccacgaaccagatgggaagcagttcctcggatccacgctatgtggat
gtgacttacatagttgaaccagaccctcctatgaacctgactttggaaataaaacagcca
gaagaccaaaaaccatacctgtggataaaatggcttccacccacccaggttgacataaga
tccggttggctcacactccagtatgaaattcggttaaagcctgagaaagctgctgagtgg
gagattcattttgctgggcagcaaactcagtttaagattctcagcttatatccaggacag
aaataccttgtccaggttcgctgcaagccagaccacggattctggagtgagtggggccca
gagggctccatccagatccccgatgattccaccaatacagataccaccgtctggatcttt
gtggctgtgctctctgttgtcatctgtttgattatagtctgggcagtggctttgaagggc
tatagcatggtgacctgcgtctttccaccggttcctgggccaaaaataaaaggatttgat
attcatctgctggaaaagggcaagtctgaagaactcctgagtgccctgggatgccaagac
ttcccttctgactgtgaggacttgctggtggagcttttagaagtcgttgacagtgagaac
cagcagctgatgccaggccattcaaaagaacacccagatcaaggtacgaagcccaaacac
ctggatgccgacactgactctggccagggcagctgtgacagcccttcccttttgtccaac
aattgtgaggagccccaggaaaatccctccacagtccacattcctgagggcattgagatg
ccagagaaccctgaaggaaatggtacccacacctgggaccctcagagcacaagctcggaa
ggcagaatcccctatttctatgctgatggacccaaatgttcaacatggccttcatcacag
ctccccagccagcacaacaccagatcttcttaccacaacattgccgatgtgtgtaagctg
gccatgggcacggcaggtgccttagccactttgttggacaaaacagacaaacatgctcta
ccatctttgcaaaccactaagactggagaggaggaaacggcagctgagcagagggaggtg
gagagcctccaacccaagactgacccagacaccccgtggctgctgccccaggagaaaact
tcctttatctctgctaagccattggattacgtggagattcacaagatcaacaaagatgga
gagttatcattgctccccaaacacaaagagaacagcaaccagacagagaaggtcggggct
cctagaaccagcaaggagtacgcgaaggtgtccagggtgatggataacaacatcctggtg
ttggtgcaggatccgcctgctcaagacctggctttgttggaagagccagctgaggaagcc
ccagcatccttgcaacagaatcaagaggagaaagacctggcctccttcacggcgacacca
agcaactgcaggctccagctgggtgggttggattacctggaccccacgtatttaaagcac
tctttccagtga

KEGG   Miniopterus natalensis: 107546370
Entry
107546370         CDS       T05883                                 

Symbol
IL7R
Name
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04068  FoxO signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna05200  Pathways in cancer
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107546370 (IL7R)
   04068 FoxO signaling pathway
    107546370 (IL7R)
   04151 PI3K-Akt signaling pathway
    107546370 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107546370 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107546370 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107546370 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    107546370 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107546370 (IL7R)
   04090 CD molecules [BR:mna04090]
    107546370 (IL7R)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL2 receptor family
   107546370 (IL7R)
CD molecules [BR:mna04090]
 Proteins
  107546370 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 107546370
NCBI-ProteinID: XP_016080234
LinkDB
Position
Unknown
AA seq 458 aa
MTIPGTAFGIVFSLLQVVSGESGYAQNGDLEDAEPDYSFSCYSQLEVDGSQHLLNCTFDD
PDVNSTNLEFEICDGLVDVKCLNFNKLQEIYFIKTNKFLLIGDSKICVKLGQKILTCRKM
NIVHIVKPEAPFDIRVTYREEANDFVVTFNTSHLQKNYVKQLLHEVTYRQEKNEGDWMHV
NLSSTKLILLQRKLQPDAMYEIKVRSIPTAGYFEGFWSEWSPSFHFRTPETKGSGKMEPV
LLIVSILSFFSVAAMIILACVLWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPE
SFLDCQIHKVDGIQARDEVEGFLQDAFPAQLEESEKQRLGGSEQGPNLPSEQAVITPKAF
RGDVPLRYLAGNASVCDTPEIPSCRSPGCREGGKNRPHVYQGLLLAPGTTNGSLHPPFPF
QLESLTLNPAAQGQPLLTPLGSNQEEAYVTMSSFYQNQ
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgacaattccaggtacagctttcggtattgtcttctctttacttcaagtcgtttcagga
gaaagtggctatgcacagaacggggacctggaagacgcagagcccgactactcgttttcc
tgctacagtcagctggaggtggatgggtcccagcacctgctaaactgcacttttgacgac
cccgacgtcaacagcaccaatctggaatttgaaatatgtgacggcctcgtggatgtaaag
tgcctgaattttaacaaactgcaagagatatatttcatcaagacaaataaattcttactg
attggagacagcaaaatatgtgtgaagcttggacaaaagatcttaacttgcagaaaaatg
aacatagtccatatagttaaacctgaggctccttttgacataagagtcacctatcgtgag
gaagcaaatgactttgtggtgacatttaatacgtcacacttgcagaagaattatgtaaaa
caattactacatgaggtcacctatcgccaggaaaaaaatgaaggtgattggatgcacgtg
aatttatccagtacgaagctgatactcctacagaggaaactacagcctgatgcaatgtat
gagattaaagtccgatccatccctaccgccggctattttgaaggcttctggagtgaatgg
agtccaagtttccacttcaggaccccagaaaccaagggctcaggaaagatggagcctgtt
ctgctaatagtcagcattctgagtttcttctctgtggctgcgatgattatcttggcctgt
gtgttatggaaaaaaagaattaagcctattgtatggcccagtctcccagatcataagaag
actctggagcaactgtgcaagaaaccaaaaaagaatttgaacgtgagtttcaatcctgaa
agtttcctggactgccagattcataaggtggatggcattcaagctagagacgaagtggaa
ggctttctgcaagatgcatttcctgcacaactagaagagtctgagaagcagaggcttgga
gggagtgagcagggccccaacttgccaagcgagcaggcagtcatcaccccaaaagctttc
agaggagatgtacccctcaggtacctggctgggaatgccagtgtgtgtgatacccctgag
atcccctcctgcaggtccccaggctgcagggaaggtggcaagaacagacctcatgtgtac
cagggcctgctgcttgcgcctggaacgacaaatggcagtctgcaccctccgtttcctttc
caattggaaagcctgacactgaacccggctgcccagggacagcccctcctcactcccttg
ggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

DBGET integrated database retrieval system