KEGG   Miniopterus natalensis: 107526074
Entry
107526074         CDS       T05883                                 

Gene name
PRF1
Definition
(RefSeq) perforin-1
  KO
K07818  perforin 1
Organism
mna  Miniopterus natalensis
Pathway
mna04210  Apoptosis
mna04650  Natural killer cell mediated cytotoxicity
mna04940  Type I diabetes mellitus
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107526074 (PRF1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107526074 (PRF1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107526074 (PRF1)
   05330 Allograft rejection
    107526074 (PRF1)
   05332 Graft-versus-host disease
    107526074 (PRF1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107526074 (PRF1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107526074 (PRF1)
SSDB
Motif
Pfam: MACPF C2 HOCHOB Vps39_2
Other DBs
NCBI-GeneID: 107526074
NCBI-ProteinID: XP_016053910
LinkDB
Position
Unknown
AA seq 557 aa
MATHVLLLGILLLLLPTPAPGYCYTAARSECQKVRKFLPGSLLAGEGVDVTNLQRSGSFP
VNTETYLRRDRTCTLCHNTLQNNALRRLPVALTHWRAHGSGCQSHLIKAKASSTEDVAKD
AASSIRNDWRVGLEVNPKPSTNVRVSVAGSHSKEANFAAEKTHQDQYSFRSDTIECRFYS
FRLVHSPPLHPEFKKAITALPPHFNASTEPDYRSLISHYGTHFIHSMELGGRVSALTALR
TCELALEGLTANEVADCLAVEAQVSIGKLAESSMEYKACEEKKKQHKMKASFHQVYQERY
SKVVGGSHLSMPDLLFGKHTGQEQFSAWVTSLVDSPGPVDYTLEPLHVLLKKQDPRREAL
RQAVSKYLMDKARWKNCSRPCPPGQQKSPHNPCLCVCHGTSVTNQDCCPRQRGLAHLAVM
NFQATGLWGDIITSTDAYLKVFFGGQELRTGTVWNNNNPQWKTRLDFGNVILATGGPLRV
QVWDQDYGWDDDLLGTCDRAPQSSLEEVEVQCNLNHGTLKFFYLAKCLPHLTGGTCLEYA
PQGLLGEPPGNRSGAVW
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggccacccatgtgctcctcttgggcatcctactcctgctactacccacacctgcccct
ggctactgctacactgctgcgcgatctgagtgccagaaggttcgcaagtttttgcctggc
tctttgctagcaggggagggtgtggatgtgaccaatctccagcgctcaggctccttccca
gtgaacacagagacatatctacggcgggaccgcacctgcaccctctgccacaacacacta
caaaataatgccctccggcgcctgcctgtggcgctcacccactggcgcgcccacggctca
ggctgccagagccacctgatcaaggccaaggccagttccactgaggacgtggccaaggat
gcagcttccagcatccgcaatgactggcgggtggggctggaagtaaatcccaaacccagc
accaatgttcgagtatcagtggccggctcacactccaaggaagccaattttgcggccgag
aaaacccaccaggaccagtacagctttagaagtgacacaatagagtgtcgcttctacagt
tttcggctggtgcactctccgccactccaccccgagttcaagaaggccatcaccgccctg
cccccccacttcaatgcctccaccgagcccgactaccgcagcctcatctcccactatggc
acccactttatccactccatggagctgggcggcagggtctctgccctcaccgccctgcgc
acctgcgagctggccctggaagggctcacggccaacgaggtggcggactgcctggccgtc
gaggcccaggtcagcataggcaagctcgccgagtcctccatggaatacaaggcctgtgag
gagaagaagaagcagcataagatgaaagcctccttccaccaggtctaccaggagcgctac
tccaaagtggtgggtggcagccacctctccatgcccgacctgctgttcgggaagcacacc
gggcaagagcaattctcagcctgggtgacctcgctggtggactctcctggcccagtggac
tataccttggagcctctgcacgtgcttttgaagaagcaggacccacggcgggaggcactg
aggcaggccgtgagcaagtacctgatggacaaggcacgctggaagaactgcagccggccc
tgccccccagggcagcagaagagcccccataacccctgcctgtgtgtgtgccatggcaca
tcagtcaccaaccaggactgctgtccccggcagagaggcctggcccatctagcagttatg
aacttccaggccacaggtctgtggggagacataattacttccactgacgcctatttgaag
gtcttctttggaggccaggagctgaggacgggcacagtgtggaacaataacaacccccag
tggaagacacggctggactttgggaatgtgatcctggccacaggggggcccctgagggtg
caggtctgggaccaagactatggctgggatgatgacctcctcggcacctgtgaccgggca
ccacagtctagcctagaggaggtggaggtgcagtgtaacctgaatcacggtacactgaaa
ttcttctaccttgccaaatgcttgcctcacctgacagggggaacctgcctggagtacgcc
ccccaaggactgctaggggagcctccaggaaaccggagtggagcggtgtggtga

DBGET integrated database retrieval system