KEGG   Miniopterus natalensis (Natal long-fingered bat): 107526174
Entry
107526174         CDS       T05883                                 
Symbol
RNF185
Name
(RefSeq) E3 ubiquitin-protein ligase RNF185
  KO
K10666  E3 ubiquitin-protein ligase RNF5 [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107526174 (RNF185)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107526174 (RNF185)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107526174 (RNF185)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107526174 (RNF185)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 Prok-RING_4 zf-rbx1 zf-ANAPC11 zf-C3HC4_4 Baculo_IE-1 zf-UDP Rtf2 zf-RING_4 zf-Nse zf-RING_16
Other DBs
NCBI-GeneID: 107526174
NCBI-ProteinID: XP_016054040
LinkDB
Position
Unknown
AA seq 192 aa
MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCW
PCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENR
GGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLF
VALVIMFWLLIA
NT seq 579 nt   +upstreamnt  +downstreamnt
atggcaagcaaggggccctcggcctctgcatcccctgagaactccagtgcagggggaccc
agcggcagcagcaatggtgctggcgaaagcggagggcaggatagcaccttcgagtgcaac
atctgcctggacacagccaaggatgctgtcatcagcctatgcggccacctcttctgttgg
ccatgtttacatcagtggttggagacgagacctaacagacaggtgtgtccagtttgcaaa
gccggaatcagccgagacaaggtcatcccactctatggcaggggcagcactgggcagcag
gatcccagagagaagacccctccccgtcctcaaggacagaggccagagccggagaacaga
gggggatttcaaggatttggatttggagatggtggcttccagatgtcttttggaattggg
gcgtttccctttgggatatttgctacagcatttaacataaatgatgggcgacctcctcca
gctgtccctggaacaccccagtacgtggatgagcagttcctgtcacgcctctttctgttt
gtggccctggtgatcatgttctggctcctaattgcctaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107538994
Entry
107538994         CDS       T05883                                 
Symbol
RNF5
Name
(RefSeq) E3 ubiquitin-protein ligase RNF5
  KO
K10666  E3 ubiquitin-protein ligase RNF5 [EC:2.3.2.27]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107538994 (RNF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107538994 (RNF5)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107538994 (RNF5)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107538994 (RNF5)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-rbx1 zf-ANAPC11 zf-C3HC4_4 Baculo_IE-1 zf-RING_16 Rtf2 zf-Nse zf-UDP zf-RING_4
Other DBs
NCBI-GeneID: 107538994
NCBI-ProteinID: XP_016070845
LinkDB
Position
Unknown
AA seq 180 aa
MAAAEEEDGGSEGPNGERGGAGATFECNICLETAREAVISMCGHLYCWPCLHQWLETRPE
RQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNTHEPFRRGAGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
NT seq 543 nt   +upstreamnt  +downstreamnt
atggcagcagcggaggaggaggatgggggctctgaggggccaaacggcgagcggggcggg
gcaggcgcgaccttcgaatgtaatatatgtctggagactgctcgggaagctgtgatcagt
atgtgtggccacctgtactgttggccctgtcttcatcagtggctagagacacggccagag
cggcaagagtgcccagtgtgtaaagctgggatcagcagagaaaaggttgtccccctttat
gggcgagggagtcagaagccccaggatcccagattgaaaactccaccccgcccccagggc
caacgaccagctccagagagcagagggggattccagccatttggtgataccgggggcttt
cacttctcctttggtgttggtgcttttccctttggatttttcaccaccgtcttcaatacc
catgagccattccgccggggtgcaggtgtggatctgggacagggtcacccagcctccagc
tggcaggactccctcttcctgtttctcgccatcttcttctttttctggctgctcagtatt
tga

DBGET integrated database retrieval system