KEGG   Miniopterus natalensis (Natal long-fingered bat): 107526302
Entry
107526302         CDS       T05883                                 
Symbol
MAN1A1
Name
(RefSeq) mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107526302 (MAN1A1)
   00513 Various types of N-glycan biosynthesis
    107526302 (MAN1A1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107526302 (MAN1A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107526302 (MAN1A1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     107526302 (MAN1A1)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    107526302 (MAN1A1)
SSDB
Motif
Pfam: Glyco_hydro_47 Glyco_hydro_88
Other DBs
NCBI-GeneID: 107526302
NCBI-ProteinID: XP_016054208
LinkDB
Position
Unknown
AA seq 451 aa
MMKHAWNNYKRYAWGLNELKPLSKQGHSSSLFGSIKGATIVDALDTLFIMEMKDEFEEAK
SWVEENLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGEEIFREKAVELGIKLLPAFLTPSG
IPWALLNLKSGIGRNWPWASGGSSILAEFGTLHLEFVHLSHLSGNPIFAEKVMNIRSVLN
NLEKPQGLYPNYLNPSSGQWGQYHVSVGGLGDSFYEYLLKSWLMSDKTDQQAKEMYFDAV
KAIETHLIRKSSRGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGAEDAPKDRTQHYLKLG
AEIARTCHESYNRTFVKLGPEAFRFDGGVEAIATRQNEKYYILRPEVVETYMYMWRLTHD
PKYRKWAWEAVEALESHCRVDGGYSGLRDVYHRQNSYDDVQQSFFLAETLKYLYLIFSDD
DLLPLKHWIFNTEAHLLPILCSSEKEVEVHE
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgatgaaacatgcttggaataattataaacgttatgcctggggattaaatgaactgaaa
cctctatcaaaacaaggccattcgagcagtttgtttggtagtatcaaaggagcaacaata
gtagatgctctggacacacttttcattatggaaatgaaagatgaatttgaagaggcaaaa
tcatgggttgaagaaaatctagattttaatgtgaatgctgaagtttctgtttttgaagtt
aatatacgctttgttggtggtctactctcagcctactatctgtctggagaagagatattt
cgagagaaagcagtggaacttgggataaaattgctccctgcatttcttactccctctgga
ataccttgggcattgctgaatttaaaaagtgggattggaaggaactggccctgggcctcg
ggagggagcagtattctggctgaattcgggaccctgcatctggagtttgtgcacttgagc
cacttgtcaggaaaccccatctttgctgaaaaggtaatgaatattcgatcagtactgaac
aacctggaaaaaccacaaggcctttatcctaactacctgaatcccagcagtggacagtgg
ggtcaatatcatgtatcagttggaggactcggagacagcttttatgaatatttgctaaaa
tcatggctaatgtctgacaagacagatcaacaagctaaggagatgtattttgatgctgtt
aaggcgatcgagactcacttgatccgcaagtctagcaggggactgacttacatcgcagag
tggaaagggggcctcctagaacacaagatgggccacctgacctgctttgccggcggcatg
tttgcgcttggggcagaagatgctcctaaggaccggacccagcactaccttaaactcggg
gctgagattgcccgcacctgtcacgaatcttacaatcgcacatttgtgaaactgggacca
gaagctttcagattcgatggcggtgttgaagccattgctacaaggcagaatgaaaaatac
tacatcctacggccggaggttgttgagacttacatgtacatgtggcgactgactcatgat
ccaaagtacaggaaatgggcctgggaagctgtagaggccctggagagtcactgccgggtg
gacgggggctattcgggcctcagggacgtttaccacagacagaacagctacgacgacgtg
cagcagagcttcttcctggcggagacgctgaaatatctatacttaatattttctgatgac
gacctacttccactgaaacactggatcttcaataccgaggcacatcttctccctatactc
tgttcaagtgaaaaagaagtggaagtccatgaataa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107536151
Entry
107536151         CDS       T05883                                 
Symbol
MAN1B1
Name
(RefSeq) endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
  KO
K23741  endoplasmic reticulum Man9GlcNAc2 1,2-alpha-mannosidase [EC:3.2.1.209]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107536151 (MAN1B1)
   00513 Various types of N-glycan biosynthesis
    107536151 (MAN1B1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107536151 (MAN1B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107536151 (MAN1B1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.209  endoplasmic reticulum Man9GlcNAc2 1,2-alpha-mannosidase
     107536151 (MAN1B1)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    107536151 (MAN1B1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 107536151
NCBI-ProteinID: XP_016067264
LinkDB
Position
Unknown
AA seq 509 aa
MEHRRKSPGLHERSIVSWRGAVIEPEPGTGVPSRQAEAPTRPALQAPSILDGQAPPNKRQ
KAVIDAFLHAWTGYHKFAWGHDELKPVSKSFGEWFGLGLTLIDALDTMWILGLKKEFGKA
RKWVSEKLEFQKNVDVNLFESTIRILGGLLSAYHLSGDKLFLEKAEDLGNRLMPAFQTPS
KIPYSDVNIGTGVAHPPWWTSDSTVAEVTSIQLEFRELSRLTGVKKFQEAAEEVTRHVHS
LSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGRQDTQLRDDYLEA
IEGIKRHLLRKSEPSKLTFVGELTHGRFSAKMDHLVCFLPGALALGAHYGLPADHMELAR
ELMDTCYQMNRQMETGLSPEIVHFNLYAQKSQKDVQVKPADRHNLLRPETVESLFYLYRF
TGDRKYQDWGWEIFQSFNAYTRIPTGGYSSISNVQDPHNPQPKDKMESFFLGETLKYLYL
LFSDHRDLLSLDTYVFNTEAHPLPIWAPA
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggaacacagaaggaagagccctggtttacacgaaaggagcattgtcagctggcgggga
gcagtgatcgagccggagccgggcactggagtcccttccagacaggcagaggcccccacc
aggcctgccttgcaggcccccagcattctggatggacaagccccccctaacaagcgccag
aaggccgtgatagatgccttcctccacgcgtggactgggtatcacaagtttgcctggggt
cacgacgagttgaagcccgtgtccaagtcctttggcgagtggttcggcctcggcctcaca
ctgatcgacgccctggacaccatgtggattttgggtctgaagaaagaatttggaaaagcc
aggaaatgggtgtctgagaagttagagtttcagaaaaatgtggatgtcaacctgtttgag
agcaccatccggatcctgggggggcttctgagcgcctaccacctgtctggggacaagctc
ttcctggagaaggccgaagatttggggaatcggctgatgcctgcgttccaaacgccctcc
aagattccgtactcagatgtgaacatcggcactggagttgcccacccaccctggtggaca
tcggacagcacagtggccgaggtgacgagcatccagctggagttccgcgagctctctcgt
ctcacaggggtcaagaaattccaggaggccgcggaggaggtgaccaggcacgtccactcc
ctgtcgggaaagaaggatgggctggtgcccatgttcatcaacacacacagcggtctcttc
acccacctgggcgtgttcactctgggcgccagggccgacagctactacgagtacctgctg
aagcagtggatccagggcgggaggcaggacacacagttgagggacgactacctggaggcc
atcgagggaatcaaaaggcacctgctgcgcaaatctgaacccagcaagctcaccttcgtg
ggggagctcacccatggccgcttcagcgccaagatggaccacctggtgtgcttcttgccg
ggggcgctggccctgggcgcccactatggcctgcccgctgaccatatggagctggctcgg
gagctcatggatacctgctaccagatgaacaggcagatggagacaggactgagccccgag
atcgtgcacttcaacctgtatgcgcagaagagccagaaggacgtgcaggtcaagccggcc
gacaggcacaacctgctgcgtcccgagacggtggagagcctgttctacctgtaccgcttc
acgggggaccgcaagtaccaggactggggctgggagatcttccagagcttcaacgcctac
acacggatccccacaggcggctattcttctatcagcaacgtccaggacccacacaatccc
cagcccaaggacaagatggaaagcttcttcctgggggagacgctcaaatacctgtacctg
ctcttctccgaccaccgggacctgctcagcctggacacctacgtgttcaacaccgaggcc
caccccctgcccatctgggcccccgcatag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107539790
Entry
107539790         CDS       T05883                                 
Symbol
MAN1C1
Name
(RefSeq) mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107539790 (MAN1C1)
   00513 Various types of N-glycan biosynthesis
    107539790 (MAN1C1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107539790 (MAN1C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107539790 (MAN1C1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     107539790 (MAN1C1)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    107539790 (MAN1C1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 107539790
NCBI-ProteinID: XP_016071859
LinkDB
Position
Unknown
AA seq 453 aa
MMQFAWQNYKLYAMGENELRPLTMEGSEGNMFGGLRGATIIDSLDTLYLMELKEEFQEAK
AWVEKNFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRVKAIKLGEKLLPAFNTPTG
IPKGVVNFKSGSNRSWGWTMAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKVRHIRKVL
RNISKPFGLYPNFISPVSGNWMQHHVSVGGLGDSFYEYLIKSWLMSAKTDMEAKDMYYKA
LKAIDTYLVKVSPEGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAEEDKRAHYREL
AAQITKTCHESYDRSDTKLGPEAFWFNSGKEAMATQLSESYYILRPEVVESYMYLWRQTH
NPIYREWGWEVVMALEKYCRTKTGFSGIQNVYSSVPSYDNKQQTFFLAETLKYLYLLFSE
DDMLSLEDWVFNTEAHPLPVNHSDSAGRVGDQL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgatgcagttcgcctggcagaactacaagctttacgcgatgggagaaaatgaactccgg
cccctcacaatggaaggctccgagggcaacatgttcggaggcctcagaggggcgactatc
attgactcccttgataccctctaccttatggagctgaaggaggagttccaggaggccaag
gcctgggttgaaaagaacttccacctgaacgtgagtggagaagcatctttgtttgaggtg
aacatccggtacatcggaggactcctctcagccttctacctgacaggagaggaggtgttc
cgagtaaaggccatcaagctcggagagaaactcctgccggccttcaacacccccacggga
atcccaaaaggtgtcgtgaacttcaaaagtggctccaacaggagctggggctggaccatg
gccgggagtagcagcatcctggcggagtttggatccctgcacttggagttcttacacctc
actgagctctctggcaaccaggtcttcgctgaaaaggtcaggcacatccggaaggtcctc
aggaatatcagtaagcccttcggcctctaccccaacttcatcagtccagtgagtgggaac
tggatgcaacaccacgtctcggtcggaggactcggggacagtttttatgaatatctgatc
aaatcctggttgatgtcggccaagacagatatggaggctaaagatatgtactacaaagcc
ttgaaggcaatagatacctacttggtgaaagtgtctcctgaggggctgacctacattgct
gagtggcgcggggggattctggaccacaagatggggcacctggcctgtttctccgggggc
atgatcgccctcggtgccgaggatgccgaggaggacaagagggcccactaccgagaactc
gcagcccagatcactaagacgtgccacgagtcgtacgaccgctcagataccaaactgggg
cccgaggccttctggtttaactccggcaaagaagcaatggccacgcagctgagcgagagc
tactacatcctgagacctgaggtggtggagagctacatgtacttatggcggcagacccac
aaccccatctacagggagtggggctgggaagtggtgatggccttggagaaatactgtcgg
acaaaaaccggtttctctgggatccagaacgtgtacagtagcgttcccagctacgacaac
aagcagcagaccttctttctagcggagacactaaagtatctctatcttctgttctctgaa
gatgacatgctctccctagaagactgggtgttcaacacggaggcccacccactccccgtg
aaccactcggacagcgctggcagggttggggaccaactctga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545314
Entry
107545314         CDS       T05883                                 
Symbol
MAN1A2
Name
(RefSeq) mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna00513  Various types of N-glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107545314 (MAN1A2)
   00513 Various types of N-glycan biosynthesis
    107545314 (MAN1A2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545314 (MAN1A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107545314 (MAN1A2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     107545314 (MAN1A2)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    107545314 (MAN1A2)
SSDB
Motif
Pfam: Glyco_hydro_47 DUF6474
Other DBs
NCBI-GeneID: 107545314
NCBI-ProteinID: XP_016078868
LinkDB
Position
Unknown
AA seq 640 aa
MTTPALLPLSGRRIPPLNLGPPAFPHHRATLRLSEKFILLLILSAFVTLCFGAFFFLPDS
SKHKRFDLGLEDVLIPHVDASKGAKNPGASLIHGPDEHRHREEEERLRNKIRADHEKALE
EAKEKLKKSREEIRAEIQTEKNKVVQEMKMKEKKPLPPVPIPNLLGINGGDPEDNDIRKK
REKIKEMMKHAWNNYRIYGWGHNELRPIAKKGHSTNIFGSSQMGATIVDALDTLYIMGLH
DEFRDGQKWIEDSLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEVFKIKAVQLAEKLLP
AFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFVHLSYLTGDPVYYKKVM
HIRKLLQKMDRPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEAR
KMYDDAIEAIEKHLIKKSRGGLTFIGEWKNGHLEKKMGHLACFAGGMFALGADGSRDKAG
HYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWYL
WRFTHDPRYRQWGWEAALAIEKHCRVSGGFSGVKDVYSSTPAHDDVQQSFFLAETLKYLY
LLFSGDDLLPLDYWVFNTEAHPLPVLHLANTTLSGNPAVR
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgactaccccagccctgctgcccctgtctggacgaaggataccgcccctgaacttgggg
ccgcctgccttcccgcaccacagagctaccttgaggctgtccgagaagttcattctcctc
ctcatcctaagtgccttcgtcaccctgtgctttggggcgttcttcttccttccagactct
tcaaaacacaaacgctttgacctgggtttggaagatgtgttaattcctcacgtagatgcc
agcaaaggggctaaaaaccccggagcctccctgattcatggacccgatgagcatagacac
agggaagaagaggaacgtttgagaaataaaattcgagctgatcacgagaaggccctggaa
gaagcaaaagaaaaattaaaaaagtcgagagaggaaattcgagcagaaattcagacagag
aaaaataaggtagtccaagaaatgaagatgaaagagaaaaagccactgccaccagtccct
ataccaaaccttttaggaataaatggtggagacccagaagataatgacataagaaagaaa
agggaaaaaattaaagagatgatgaaacatgcctggaataattataggatatatggatgg
ggacataatgaactcagacctattgcaaagaaaggacactccactaatatatttggaagt
tcacaaatgggtgctaccatagtagatgctttggataccctttatatcatgggactccat
gatgaattccgagatgggcaaaaatggattgaagacagtctagatttcagtgtgaattca
gaggtgtctgtgtttgaagtcaacattcgatttattggcggcctactcgcagcgtattac
ctttcaggagaggaggtattcaagattaaagcagtgcagttggctgagaagctccttcct
gcctttaacacacccactgggattccctgggcaatggtgaatctgaaaagtggagtcggg
cggaactggggctgggcatctgcaggtagcagcattcttgctgaatttgggacactgcat
atggagtttgtccacctcagctacttgacaggggacccggtttactacaaaaaggtcatg
cacattcggaaactacttcagaaaatggatcgtccaaatggtctttatccaaattatttg
aacccaagaacaggtcgctggggtcagtatcacacatcagttggcgggctaggggacagt
ttttatgaatacttactgaaagcatggttgatgtcagataaaacagaccatgaggcgaga
aaaatgtatgatgatgccattgaggctatagaaaaacatcttattaagaagtcccgtgga
ggcctaacctttattggagaatggaagaatgggcacctggaaaagaagatggggcatttg
gcctgctttgctgggggaatgtttgcacttggagcagatggttccagggacaaagctggt
cattatttagagctaggggcagaaattgcacgtacatgtcacgagtcatatgatagaact
gcattgaagctgggccccgagtccttcaagtttgatggcgcagtagaggctgtggcggtc
cggcaggctgagaagtattacattctccggccagaagtcatcgaaacctattggtacctg
tggcggttcactcacgatccaagatacaggcagtggggctgggaagcagctctggctatt
gagaagcactgccgagtcagtggtgggttctctggggtaaaggatgtgtattcctcgacc
cctgcacacgatgatgtacagcagagcttctttctcgctgaaacattaaagtatttgtat
ctgctgttctccggtgatgaccttttgcccttagactactgggtgttcaatacagaggct
caccctctgcccgtgttgcatttagccaacaccacactttcaggaaatcctgctgttcga
tga

DBGET integrated database retrieval system