KEGG   Miniopterus natalensis (Natal long-fingered bat): 107526368
Entry
107526368         CDS       T05883                                 
Symbol
NGLY1
Name
(RefSeq) peptide-N(4)-(N-acetyl-beta- glucosaminyl)asparagine amidase isoform X1
  KO
K01456  peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase [EC:3.5.1.52]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107526368 (NGLY1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.52  peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase
     107526368 (NGLY1)
SSDB
Motif
Pfam: PAW PUB Transglut_core Rad4 TFIIE_alpha
Other DBs
NCBI-GeneID: 107526368
NCBI-ProteinID: XP_016054283
LinkDB
Position
Unknown
AA seq 629 aa
MFTSGVRRRRASFNSDSGRNPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGET
HLIFPKKASVEQLQKIRDLIATERSSRLDGSNKSHKVELSQQPVASTQLPTAQSSNPNGL
TQHARNSEGRSSNPPSAPMITADSIILKVLRSNLQHVLVYENLALQEKALACIPVQELKE
RSQEKLSRARKLDKGTNLSDEDFLLLELLHWFKEEFFQWVNDILCSKCGGKTKSRGEALF
PTDDELKWGANRVEDHYCDVCQFSNRFPRYNHPEKLLETRRGRCGEWANCFTLCCRALGF
EARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCDKPLLYEVGWGKKLSYILAFSKDEVV
DVTWRYSCKHEEVISRRTQIKEELLRETINGLNKQRQISLSENRRKELLQRIIVELVEFI
SPKTPKPGELGGRISGSVAWRVARGEMGLEKKETMFTPSENEKISKQLHLCYNIVKDHYI
RVSDNHQTTSGWESGVWKTESIFRKVETDWNMVYLARREGSSSAYISWKFECGSVGLKLD
SISIRTSSQTFQTGEIQWKLRSDTAQVELRGDGILRSYDDFSGATEVILEAELSRGDGVV
AWQHTQLFRQSLNDHEENCLEIIMKFSDL
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgttcacatctggggtccgccgtcgacgcgcctctttcaatagtgattcgggaagaaac
cctaatgatgaaaaatacagatctatccggattggaaacacagctttttccactagactc
ctgcccgtcagaggagcagttgaatgtctatttgaaatgggctttgaagagggagaaaca
caccttatctttcctaagaaagcgtcagtggagcagctgcaaaaaattcgtgacctcatt
gccacagagagaagtagcagattggatggatcaaataagagccacaaagtagaattatct
cagcaacctgtagctagtacccagcttcctacagcacagtcttcaaatcctaatgggtta
acccagcatgcaaggaacagtgaagggcggtcatcaaatccaccatctgctccaatgatt
actgctgattcaatcattctgaaagttcttcgatccaaccttcagcatgtactggtctat
gagaatcttgctctccaggagaaagcattggcttgtattccagtccaagaactaaaagag
agatctcaagagaaattatctagagctagaaaattggataaaggtactaatttaagtgat
gaggattttcttttgctggagcttttacactggtttaaggaagaattttttcaatgggtg
aatgacattttgtgcagcaaatgtggtggcaagactaagtctagaggtgaagcgttattt
cccactgacgatgagttgaagtggggtgcaaacagagtggaagatcattattgtgatgtg
tgccagttcagcaatcgattcccgaggtataatcaccctgagaaacttttggaaacgagg
cgtggacggtgtggcgagtgggccaattgttttacactgtgctgccgagccttagggttt
gaagctcgctacgtctgggattacacagaccatgtctggacagaagtctactctccttct
cagcagcggtggctgcactgtgatgcctgtgaagatgtctgtgacaaacctctcctttat
gaagtagggtggggcaagaagctgtcctacatcctagcattttctaaagatgaggtggtt
gatgtcacttggcgatattcttgtaaacatgaagaggtgatttccagaagaactcagatt
aaagaagaattacttcgagaaactattaatggacttaataagcagaggcaaatatctttg
tcagaaaacagaagaaaagaacttctccagaggataattgtggagcttgttgaatttata
tctcccaaaacccccaaacctggagaacttggtggacgaatatctgggtcagtggcttgg
agagtagcccgaggtgaaatgggcctagagaaaaaagaaaccatgttcaccccctctgaa
aatgagaagatttctaaacagcttcacctttgttataatattgtgaaagatcattacatt
cgagtttcagataatcatcaaaccacttctggatgggaaagtggtgtgtggaaaacggaa
tccatattcagaaaagttgaaacagactggaacatggtgtatttagcccgaagagaagga
tcatcttctgcttatatttcctggaagtttgagtgtgggtcggttggcctaaaactagat
agcatttccattagaacaagcagtcagacctttcagactggagaaatacagtggaaactg
cgatctgatacagcacaagtagaactgcggggcgatggaattcttcgctcatatgatgat
ttttctggtgccactgaagttattttggaagcagaattgagcagaggagatggtgttgtt
gcttggcaacatactcaactatttagacaaagcttaaatgaccatgaagaaaattgtttg
gagataattatgaaattcagtgacctttaa

DBGET integrated database retrieval system