KEGG   Miniopterus natalensis: 107526510
Entry
107526510         CDS       T05883                                 

Gene name
CLDN15
Definition
(RefSeq) claudin-15
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107526510 (CLDN15)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107526510 (CLDN15)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107526510 (CLDN15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107526510 (CLDN15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107526510 (CLDN15)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107526510 (CLDN15)
  Exosomal proteins of colorectal cancer cells
   107526510 (CLDN15)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 107526510
NCBI-ProteinID: XP_016054463
LinkDB
Position
Unknown
AA seq 235 aa
MSVAVETFGFFMAAVGLLMLGVTLPHSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVH
NCWEFPSMLALSGYIQACRALMITAILLGFLGLFLGMMGLRCTNIGGVVLSRKAKLAATA
GALYILAGCCGMVAITWYASNITRNFFDPTYSGTKYELGPALYLGWSASLLTILGGVCLC
SNCCCPPEEDRATSTRLPYKASAARSTSLAAHLRPAASDEEGDISFGKYGKNAYV
NT seq 708 nt   +upstreamnt  +downstreamnt
atgtcagtggctgtggagacctttggcttcttcatggcagccgtggggctgctgatgctg
ggtgtgaccctgccacacagctactggcgagtgtctactgtgcacgggaatgtcatcacc
accaacaccatcttcgagaacctctggtacagctgcgcaaccgactccctgggagtccac
aactgctgggagttcccgtccatgctggccctctccgggtacatccaggcctgccgggca
ctcatgatcactgccatcctcctgggcttcctgggcctcttcttgggcatgatgggactg
cgctgcacaaacattgggggcgtggtgctctccaggaaagccaagctggcggccactgcg
ggggccctatacatactggctggttgctgcgggatggtggccatcacctggtacgcctcc
aacatcacccggaacttcttcgaccccacgtattctggaaccaagtatgagctgggccct
gcgctctacctgggctggagcgcctccctgctgaccatcctgggcggcgtctgcctctgc
tccaactgctgctgtcctcctgaggaggaccgcgccaccagcacccggctcccctacaag
gcctcggcagcgcggtccactagcctcgctgcccacctgcgccccgcagcctcggatgaa
gaaggcgacatcagcttcggcaaatacgggaaaaacgcttacgtgtag

KEGG   Miniopterus natalensis: 107526582
Entry
107526582         CDS       T05883                                 

Gene name
CLDN3
Definition
(RefSeq) claudin-3
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107526582 (CLDN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107526582 (CLDN3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107526582 (CLDN3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107526582 (CLDN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107526582 (CLDN3)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107526582 (CLDN3)
  Exosomal proteins of colorectal cancer cells
   107526582 (CLDN3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Other DBs
NCBI-GeneID: 107526582
NCBI-ProteinID: XP_016054565
LinkDB
Position
Unknown
AA seq 220 aa
MSMGLEITGTALAVLGWLGTIVCCALPMWRVTAFIGSSIITAQITWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLGAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIVQDFYNPLVPDSQKREIGSGLYVGWAAAALQLLGGALL
CCSCPPQEKKYVPTKILYSAPRSAGPGTGTGTAYDRKDYV
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtccatgggcctggagatcacgggcaccgcgctggccgtgctgggctggctgggcacc
atcgtgtgctgtgcgctgcccatgtggcgggtgacggccttcatcggcagcagcatcatc
accgcacagatcacctgggagggcctgtggatgaactgcgtggtgcagagcaccggccag
atgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcccgc
gccctcatagtggtcgccatcctcctgggcgcttttgggctcctcgtggcgctcgtgggc
gcccagtgcaccaactgcgtgcaggacgacaccgccaaggcaaagatcaccatcgtggcg
ggcgtgctcttcctgctggccgccctgctcaccctcgtgccggtgtcctggtcggccaac
accatcgtccaggatttctacaaccccctggtgcccgattcgcagaagcgcgagataggc
tctggcctgtacgtgggctgggcggccgcggcgctgcagctcctggggggcgcgctgctg
tgctgctcgtgcccgccgcaggagaagaaatacgtgcccaccaagatcctctactcggcg
ccgcgctccgctgggccaggcacgggcaccggcacagcctacgaccgcaaggactacgtc
tga

KEGG   Miniopterus natalensis: 107526583
Entry
107526583         CDS       T05883                                 

Gene name
CLDN4
Definition
(RefSeq) claudin-4 isoform X1
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107526583 (CLDN4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107526583 (CLDN4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107526583 (CLDN4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107526583 (CLDN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107526583 (CLDN4)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107526583 (CLDN4)
  Exosomal proteins of colorectal cancer cells
   107526583 (CLDN4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37 L_HMGIC_fpl TMEM_230_134
Other DBs
NCBI-GeneID: 107526583
NCBI-ProteinID: XP_016054566
LinkDB
Position
Unknown
AA seq 209 aa
MASMGLQVMGIALAVLGWLGAILSCALPMWKVTAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSMLALPQDLQAARALIVVCIVLAVLGVLLSVVGGKCTNCVEDESTKAKVMIV
AGVVFLLAGLLVMVPVSWTANTIIRDFYNPLVASGQKREIGASLYVGWAAAGLMMLGGAL
LCCNCPPRADKPYSAKYSAARSAPASNYV
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcctccatggggttacaggtgatgggcatcgcgctggccgtgctgggctggctgggc
gccatactgagctgtgcgctgcccatgtggaaggtgacggccttcatcggcagcaacatc
gtcacatcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgattctatgctggcgctgccgcaggacctgcaggcggcc
cgcgccctcatcgtggtctgcatcgtcctggccgtgctgggcgtgctgctgtccgtggtg
ggtggcaagtgcaccaactgcgtggaggatgagagcaccaaagccaaggtcatgattgtg
gcgggagtggtgtttcttctggccggcctgctggtgatggtgcccgtgtcctggacggcc
aacaccatcatccgcgatttctacaatccgctggtggcctccggccagaagcgggagata
ggtgcctcgctctacgtgggctgggcggccgccgggctgatgatgcttggcggggccctg
ctctgctgcaactgcccgccccgcgctgacaagccctactcggccaagtattctgccgcc
cgctctgcccccgccagcaactacgtgtaa

KEGG   Miniopterus natalensis: 107527299
Entry
107527299         CDS       T05883                                 

Gene name
CLDN1
Definition
(RefSeq) claudin-1
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107527299 (CLDN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107527299 (CLDN1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107527299 (CLDN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107527299 (CLDN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107527299 (CLDN1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107527299 (CLDN1)
  Exosomal proteins of colorectal cancer cells
   107527299 (CLDN1)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin SUR7 CD20 DUF3169 Cytochrom_B_C DUF4282 YccF
Other DBs
NCBI-GeneID: 107527299
NCBI-ProteinID: XP_016055542
LinkDB
Position
Unknown
AA seq 211 aa
MANAGLQLLGFILAFLGWVGAIVSTALPQWKVHSYAGDNIVTAQSIYEGLWMSCVSQSTG
QIQCKVFDSLLNLNSTLQATRALMVVSILLGLIAIFVATVGMKCMKCLEDDEVQKMRMAV
IGGVIFLIAGLAALVATAWYGHRIVQEFYDPMTPVNARYEFGTALFTGWAAASLCLLGGA
LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaacgcggggctgcagctgctgggcttcatcctggccttcctgggctgggtgggg
gccatcgtcagcaccgcgctgccccagtggaaggtccactcctacgcgggcgacaacatc
gtgaccgcccagtccatctacgaggggctctggatgtcctgcgtgtcgcagagtacgggg
cagatccagtgcaaagttttcgactccttgctgaatctgaacagcactttgcaagcaact
cgtgccttgatggtggttagcatcctgctgggactaatagctatcttcgtggccactgtt
ggcatgaagtgtatgaagtgcctggaagacgatgaagtccagaagatgcggatggccgtc
atcgggggcgtgatatttcttatcgcaggtctggctgctttagttgccacagcatggtat
ggccacagaattgttcaagaattctatgaccccatgaccccagtcaatgccaggtatgaa
tttggcactgctctcttcactggctgggctgctgcttccctctgccttctgggaggtgcc
ctactttgctgctcctgtccccgaaaaacaacatcttacccaacaccaaggccctatccc
aaacctgcaccttccagtgggaaagactatgtgtga

KEGG   Miniopterus natalensis: 107527366
Entry
107527366         CDS       T05883                                 

Gene name
CLDN16
Definition
(RefSeq) claudin-16
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107527366 (CLDN16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107527366 (CLDN16)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107527366 (CLDN16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107527366 (CLDN16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107527366 (CLDN16)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107527366 (CLDN16)
  Exosomal proteins of colorectal cancer cells
   107527366 (CLDN16)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like DuoxA
Other DBs
NCBI-GeneID: 107527366
NCBI-ProteinID: XP_016055619
LinkDB
Position
Unknown
AA seq 280 aa
MTSRTPVWVTACLCNSDGNSRRPQRGVRRRGRPLPGCPRRRLLADMRHLLQHVACFFALC
STGFLVAATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKL
VVTRALMITADILAGFGFITLLLGLDCVKFLPDEPYIKVRLCFVAGTTLLIAGAPGIIGS
VWYAVDVYVERSSLILHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGP
GRNYPYSVRKAYSNAAVSVAKSYVAPRTETAKMYAVDTRV
NT seq 843 nt   +upstreamnt  +downstreamnt
atgacctccaggacccctgtgtgggttacagcctgcttgtgtaactccgacggcaactca
agacgcccgcagcggggtgtgagaagaaggggcaggccgctcccgggctgcccacgacgg
cggctgctcgctgacatgaggcatcttcttcagcacgtcgcctgcttcttcgccctgtgc
tctacgggcttcttggtggcagccacctggacagactgttggatggtgaatgccgatgac
tccctggaggtgagcacaaaatgcagaggcctctggtgggagtgtgtcacaaatgctttc
gatggcattcgcacctgcgatgagtacgattctatactcgcggagcaccccttgaagctg
gtcgtaactcgggcattgatgattactgcagatatcctagctgggtttggatttatcacc
ctactccttggtctggactgcgtgaaattcctccctgatgagccatacatcaaagtccgc
ctctgctttgttgctggaaccacattactaatagcaggtgccccaggaattatcggctct
gtgtggtatgctgtcgatgtttatgtggaacgttcttctctgattttgcacaatatattt
cttggcatccaatataaatttggttggtcctgttggcttggaatggctgggtctctgggt
tgctttttggctggggctgtcctcacatgctgcttatacctcttcaaagacgtgggacct
ggaaggaactacccttattccgtgaggaaggcctattcgaatgcagctgtttccgtggcc
aagtcctacgtggccccccggacagagactgccaaaatgtatgctgtggacacgagggtg
tag

KEGG   Miniopterus natalensis: 107527824
Entry
107527824         CDS       T05883                                 

Gene name
CLDN20
Definition
(RefSeq) claudin-20
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107527824 (CLDN20)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107527824 (CLDN20)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107527824 (CLDN20)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107527824 (CLDN20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107527824 (CLDN20)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107527824 (CLDN20)
  Exosomal proteins of colorectal cancer cells
   107527824 (CLDN20)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 107527824
NCBI-ProteinID: XP_016056171
LinkDB
Position
Unknown
AA seq 220 aa
MPSTGLQLLAFVLAFCGVSGVLAATLLPNWMVNLDTGSNIITSIIQVQGLWMDCTCYSTG
MFSCTLKFSVLTLPIHVQAARATMVLACVLSALGICTSTVGMQCIRLGGDRETKSHSSFA
GGICLMSAGISGIIPTVWYTKEIIANFLDLTVPESNKPEPGGAIYIGFIAAMLLLISGAI
FCTSCMRKEDPEAWLSPPKQRQSPTAKLEGTSAYNLRDYV
NT seq 663 nt   +upstreamnt  +downstreamnt
atgccctcaacgggcctccagctccttgcttttgtcctggccttctgtggggtctctgga
gtgctggcagccaccctgctgcccaactggatggtgaacctggacacgggctccaacatc
atcacgtccatcatccaggtgcaggggctgtggatggactgcacgtgctacagcaccggc
atgttcagctgcaccctcaagttctccgtcctgaccctccccatccacgtgcaggctgcg
cgggccaccatggtcctggcttgtgtcctgtctgctctagggatctgcacttccacggtg
ggaatgcaatgcattcgcttaggaggggacagagagaccaagagtcactcttccttcgct
ggaggcatctgtctcatgtctgcagggatctctgggataataccaactgtgtggtacacg
aaggagatcatcgcaaactttctggatctgacagtcccagagagcaacaaacctgagccc
ggaggagccatctacattgggttcattgcggccatgctgctgttgatctctggcgcaatt
ttctgcacttcctgcatgaggaaggaggacccagaggcttggctctccccgcccaagcag
cggcagagccccaccgcaaagctcgagggcacttcagcttacaacctgagggattacgtg
tag

KEGG   Miniopterus natalensis: 107529521
Entry
107529521         CDS       T05883                                 

Gene name
CLDN11
Definition
(RefSeq) claudin-11
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107529521 (CLDN11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107529521 (CLDN11)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107529521 (CLDN11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107529521 (CLDN11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107529521 (CLDN11)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107529521 (CLDN11)
  Exosomal proteins of colorectal cancer cells
   107529521 (CLDN11)
SSDB
Motif
Pfam: PMP22_Claudin
Other DBs
NCBI-GeneID: 107529521
NCBI-ProteinID: XP_016058463
LinkDB
Position
Unknown
AA seq 197 aa
MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA
QLAGVLLILLALCAIVATIWFPVCSLESSVHLTFQHISVVPATPCVLSGHGTSGYWIGQH
SIEQQVCPQYPLRGIQS
NT seq 594 nt   +upstreamnt  +downstreamnt
atggtggccacgtgcctgcaggtagtgggcttcgtgacgagcttcgtgggttggatcggc
atcatcgtcaccacctccaccaacgactgggtggtgacttgcggctacaccatcccgacg
tgccgcaagctggacgagctgggctccaaggggctgtgggccgactgcgtcatggccacg
gggctgtaccactgcaagccgctggtggacattctcattctgccgggctacgtgcaggcc
tgccgggccctgatgatcgcagcctcagtcctgggcctgccggccattctcctgctgctg
acggtcctcccctgcatccgcatgggccacgagcccggcgtggccaagtacaggcgagcc
cagctggctggcgttctgctcattctcctggcgctctgcgccatcgtggccaccatctgg
ttccccgtgtgctctttggagtccagtgtgcatttgaccttccagcacatctctgttgta
ccagccactccttgcgtgctcagtggccatgggactagcggctattggatcgggcagcac
agtatagaacagcaggtctgccctcagtacccattaagagggattcagtcttga

KEGG   Miniopterus natalensis: 107530497
Entry
107530497         CDS       T05883                                 

Gene name
CLDN5
Definition
(RefSeq) claudin-5
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107530497 (CLDN5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107530497 (CLDN5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107530497 (CLDN5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107530497 (CLDN5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107530497 (CLDN5)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107530497 (CLDN5)
  Exosomal proteins of colorectal cancer cells
   107530497 (CLDN5)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 107530497
NCBI-ProteinID: XP_016059756
LinkDB
Position
Unknown
AA seq 218 aa
MGSAALEILGLVLCLMGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTG
HMQCKVYDSVLALSTEVQAARALTVGAVLLALVALCLTLAGAQCTTCVAPGPSKARVALT
GGALYAFCGLLALVPLCWFANIVVREFYDPNVSVSNKYELGAALYIGWAASALLMCGGGL
VCCGAWVCAGRPDLSFPVKYSAPRRPAAGGDYNKKNYV
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggtcggcagcgctggagatccttggcctggtgctgtgcctgatgggctgggtgggc
ctgatcttggcgtgcgggctgcccatgtggcaggtgacggctttcctggaccacaacatc
gtgacggcgcagaccacctggaaagggctgtggatgtcgtgcgtggtgcagagcacgggg
cacatgcagtgcaaggtgtatgactcggtgttggcgctgagcaccgaggtgcaggcggcg
cgggcgctcactgtgggcgccgtcctgctggcgctggtcgcactctgcctgaccctggcg
ggggcgcagtgcaccacctgcgtggccccgggtcccagcaaggcgcgcgtggctctcacg
ggcggcgcgctctacgcgttctgcgggctgctggcgctcgtgccgctctgctggttcgcc
aacattgtggtccgcgaattctacgacccgaatgtatccgtgtcgaacaagtacgaactg
ggcgcggcgttgtacatcggctgggcagcctcggcgctgctcatgtgcggtggtggcctc
gtgtgctgcggcgcctgggtctgcgcgggccgccccgacctcagcttccctgtgaagtac
tcggcgccgcggcggcccgcggccggcggtgactacaacaagaaaaactacgtctga

KEGG   Miniopterus natalensis: 107531162
Entry
107531162         CDS       T05883                                 

Gene name
CLDN19
Definition
(RefSeq) claudin-19
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107531162 (CLDN19)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107531162 (CLDN19)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107531162 (CLDN19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107531162 (CLDN19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107531162 (CLDN19)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107531162 (CLDN19)
  Exosomal proteins of colorectal cancer cells
   107531162 (CLDN19)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Mntp
Other DBs
NCBI-GeneID: 107531162
NCBI-ProteinID: XP_016060635
LinkDB
Position
Unknown
AA seq 211 aa
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG
QVQCKLYDSLLALEGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRIAI
SGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGS
FLCCTCPEPERVNSSPQPYRPGPSTTAREYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaactcgggcctccagctcctgggctatttcctggccctgggtggctgggtgggc
atcatcgccagcacagccctcccacaatggaagcagtcctcctatgcaggcgacgccatc
atcaccgccgtgggcctctacgaagggctctggatgtcctgcgcctcccagagcactggg
caggtgcagtgcaagctctacgactcactgctcgccctggaaggtcacatccagtcagca
cgagccctgatggtggtggcagtgctactgggctttgtggccatggtcctcagtgtggtt
ggcatgaagtgcacccgggtcggagacagcaaccccatcgccaagggccgcattgccatc
tccgggggtgccctcttcctcttggcaggcctctgcaccttgactgcagtctcatggtat
gccaccctggtgacccaggagttcttcaacccgagcacacctgtcaatgccaggtacgag
tttggcccggctttgttcgtgggctgggcctctgccggcctggccatgctggggggctcc
ttcctctgctgcacgtgcccagagcctgagagagtcaacagcagcccacagccctaccgg
ccaggcccctcaactacggccagagagtacgtctga

KEGG   Miniopterus natalensis: 107531292
Entry
107531292         CDS       T05883                                 

Gene name
CLDN25
Definition
(RefSeq) LOW QUALITY PROTEIN: putative claudin-25
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107531292 (CLDN25)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107531292 (CLDN25)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107531292 (CLDN25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107531292 (CLDN25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107531292 (CLDN25)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107531292 (CLDN25)
  Exosomal proteins of colorectal cancer cells
   107531292 (CLDN25)
SSDB
Motif
Pfam: PMP22_Claudin
Other DBs
NCBI-GeneID: 107531292
NCBI-ProteinID: XP_016060816
LinkDB
Position
Unknown
AA seq 268 aa
MAWSFCGKAQLGGLLLSLLGWVCSCVTTALPQWKTINLDLNEMETWILGLWEVXVNQEEV
ATVCRALESFLSLSQGLQISHAXGLGLLGLLLSGFESECCQFHRIQRVFQRLLCILGGTX
EVSASATTIFPVSWVAYATIQDFWDDRIPGLVPRWAFGDALYLGWAAGIFLALGGFLLIC
SACLGKDVPSSQVAGPTXPLYLGPAEEFDGSFLLIPRSRNLFIRTSFCQGISGIKEYQSI
PFSSLPFIALYLFAPFGGGGGSCHCPNC
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcctggagtttctgtgggaaagcccagctcgggggactgctcctctctctcctcggc
tgggtctgttcatgtgtgaccaccgccctgccccagtggaagaccatcaatctggatctg
aacgaaatggaaacatggatcctgggactttgggaggtctgagtgaaccaggaggaagtt
gccactgtgtgccgggccttggagtccttcttatctctgtcccaggggctccagatatcc
cacgccnctgggctgggattattggggcttctgctctctggctttgagtccgaatgctgc
cagtttcacaggatccaaagggtatttcagaggttgctttgcattctaggagggactnnc
gaagtatcagcttcagccacgaccatctttccagtctcctgggtggcctatgccacaatc
caagacttctgggatgaccgcatccctgggcttgtgcctcggtgggcgtttggagatgcc
ctctacttgggctgggctgctggtattttcttggcccttggtggatttctcctcatctgc
tcagcctgcctgggaaaagatgtgccctcctcccaggtggctggtcctacangcccacta
tacctcggcccagcagaagagtttgacggctccttccttctaatcccaagatctaggaac
ctgttcattaggaccagcttctgccaaggaatctctggaataaaggaatatcagtcgatt
cctttctcttccttacccttcatcgctctgtatttgtttgccccatttgggggtggggga
gggagttgtcactgccctaattgttaa

KEGG   Miniopterus natalensis: 107532131
Entry
107532131         CDS       T05883                                 

Gene name
CLDN2
Definition
(RefSeq) claudin-2
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107532131 (CLDN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107532131 (CLDN2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107532131 (CLDN2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107532131 (CLDN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107532131 (CLDN2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107532131 (CLDN2)
  Exosomal proteins of colorectal cancer cells
   107532131 (CLDN2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin DUF973 Clc-like
Other DBs
NCBI-GeneID: 107532131
NCBI-ProteinID: XP_016061868
LinkDB
Position
Unknown
AA seq 230 aa
MASLGVQLIGYILGLLGLLGTLVAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTG
ITQCDIYSTLLGLPPDIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQDSRAKDRVAIV
GGVFFILGGLLSFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGVI
LCFSCLRQGNHSNYYDAYQAQPLATRSSPRPGQPPKVKNEFNSYSLTGYV
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcctctcttggcgtccaacttataggctatatcctgggccttctggggctgctgggc
acattggtggccatgctgctccccagctggcgaacaagttcttatgttggtgctagcatt
gtgacagcagtcggcttctccaagggcctctggatggagtgtgccacacacagcacaggc
atcacccaatgtgacatctacagcacccttctaggcctgcctcccgacatccaggctgcc
caggctatgatggtgacgtccagtgcaatctcctcgttggcctgcattatctctgtggtg
ggcatgagatgcacagtcttctgccaggattcccgagccaaggacagagtggcgatagtg
ggcggagtcttcttcatccttggaggcctcctgagcttcatccctgttgcctggaatctt
catgggatcttgcgggacttctactccccactggtgcctgacagcatgaaatttgaaatc
ggagaggctctttacttgggcattatttcctccctgttctctctggtagctggagtcatc
ctctgtttttcctgcttacgccagggaaatcactccaactactatgatgcctaccaggcc
cagcccctcgccactaggagctctccaagacctggtcaaccacccaaagtcaagaatgag
tttaactcctacagcctgacagggtatgtgtga

KEGG   Miniopterus natalensis: 107533012
Entry
107533012         CDS       T05883                                 

Gene name
CLDN34
Definition
(RefSeq) claudin-34
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107533012 (CLDN34)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107533012 (CLDN34)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107533012 (CLDN34)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107533012 (CLDN34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107533012 (CLDN34)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107533012 (CLDN34)
  Exosomal proteins of colorectal cancer cells
   107533012 (CLDN34)
SSDB
Motif
Pfam: Claudin_2 TMEM_230_134 UCR_UQCRX_QCR9
Other DBs
NCBI-GeneID: 107533012
NCBI-ProteinID: XP_016063059
LinkDB
Position
Unknown
AA seq 215 aa
MSLLVYSHKNQVMSFAITTVGWIFSMTSMGLAEWRLWYVDNSSAFPTGLATVGMWKVCTY
HHANYYKTHMKCHRYAYSDAYLPLDVRVAQNLLLASSILGLLGKVLIVLGLGNVYLGHLQ
KNATWTLFIASGALNITAGVALAVTVIWNYHAVMSREGIDFPAAFNIPFRPDRQEPGSAV
PVAVLAAFMMVLSGLLSLSYQLPPDSQVYPEAAEA
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagcctgctcgtctacagccacaaaaaccaagtaatgagtttcgccatcaccaccgtg
gggtggatcttctccatgacatccatgggcctggcggagtggcggctgtggtacgtggac
aacagctccgccttccccaccgggctggccaccgtggggatgtggaaagtctgcacgtac
caccacgccaactactacaagacccacatgaagtgccaccgttacgcctacagcgacgcc
tacctgcctctcgatgtccgcgtggcgcagaacctcctgctggcctccagcatcctgggg
ctcctggggaaggtgctcatcgtcctgggcctgggcaacgtgtacctggggcaccttcag
aagaatgccacctggaccctcttcattgcctcgggcgccctcaacataacagccggggtg
gcgctggcggtcacggtcatctggaactaccacgcggtgatgagcagggagggcatagac
ttcccggccgccttcaacatccccttcaggcccgaccgccaggagccgggcagcgccgtg
ccggtggccgtcctggcggccttcatgatggtgctgagcgggctgctctccctgtcctac
cagctgccccccgacagccaggtgtacccggaggccgcggaggcgtga

KEGG   Miniopterus natalensis: 107535846
Entry
107535846         CDS       T05883                                 

Gene name
CLDN6
Definition
(RefSeq) claudin-6
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107535846 (CLDN6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107535846 (CLDN6)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107535846 (CLDN6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107535846 (CLDN6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107535846 (CLDN6)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107535846 (CLDN6)
  Exosomal proteins of colorectal cancer cells
   107535846 (CLDN6)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 107535846
NCBI-ProteinID: XP_016066910
LinkDB
Position
Unknown
AA seq 221 aa
MASAGLQILGIVLTLLGWVNALVSCALPLWKVTAFIGNSIVVAQVIWEGLWMSCVVQSTG
QMQCKVYDSMLALPQDLQAARALCIITLLIALVGLLIYLGGAKCTTCVEDKDSKARLVLT
SGIIFVISGVLTLIPICWTAHAVIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGL
LCYTCPSGGSRGSSHYLARYSASAPRANSQGPSEYPTKNYV
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcctctgctggtctgcaaatcctggggatcgtcctgacgttgcttggatgggtgaat
gctctggtgtcctgcgccctacccctgtggaaggtgaccgccttcatcggcaatagcatt
gtggtggcccaggtgatatgggaggggctgtggatgtcctgtgtggtgcagagtacaggc
cagatgcagtgcaaggtgtacgactcaatgctggcactgccccaggacctgcaggctgcc
cgagccctctgcatcatcaccctcctcattgccctggtgggtctgctgatctacctcggt
ggggccaagtgtaccacatgtgtggaggacaaggactccaaggcccgactggtgctcacc
tctgggattatctttgtcatctcaggggtcctgactctgatccccatctgctggacggcc
catgctgtcatccaggatttctacaaccctctggtggcagaggcccaaaagcgggagctg
ggggcctccctctacctgggctgggcagcttcaggccttttgttgctgggtggggggctc
ctgtgctacacctgcccctctggggggtcccggggctccagccattacctggcccgatac
tcagcatctgccccgcgagccaactctcaggggccctctgaataccccaccaagaattac
gtttga

KEGG   Miniopterus natalensis: 107535847
Entry
107535847         CDS       T05883                                 

Gene name
CLDN9
Definition
(RefSeq) claudin-9
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107535847 (CLDN9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107535847 (CLDN9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107535847 (CLDN9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107535847 (CLDN9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107535847 (CLDN9)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107535847 (CLDN9)
  Exosomal proteins of colorectal cancer cells
   107535847 (CLDN9)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM_230_134
Other DBs
NCBI-GeneID: 107535847
NCBI-ProteinID: XP_016066911
LinkDB
Position
Unknown
AA seq 217 aa
MASAGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVMWEGLWMSCVVQSTG
QLQCKVYDSMLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
AGVILLLSGILVLIPICWTAHAIIQDFYNPLVAEALKRELGASLYLGWAASALLMLGGGL
LCCTCPPPQIDRPRGPRLGYSIPSRSGTSGMDKRDYV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcttcagctggcctagaactcctaggcatgaccctggctgtgctgggctggctgggg
accctggtgtcctgcgccctgcccctgtggaaggtgaccgccttcatcggcaacagcatt
gtggtggcccaggtgatgtgggaggggctgtggatgtcctgcgtggtgcagagcacaggc
cagttgcagtgtaaggtgtacgactcaatgctggcactgccccaggacctgcaggctgcc
cgagccctctgtgtcatcgccctcctcctggccctgctcggcctgctggtggccattacg
ggagcccagtgcaccacctgcgtggaggacgaaggtgcaaaagcccgcattgtgctcacg
gcgggcgtcatcctccttctctcaggcatcctggttctcatccccatctgctggacggcc
cacgccatcatccaggacttctacaaccccctggtggctgaagccctcaagcgggagctg
ggggcctccctctatctgggctgggcagcatctgccctgctcatgctgggcgggggcctc
ctctgctgcacatgccccccgccccagatcgaccggccacgaggacccaggctgggctac
tccatcccctcccgctcgggcacctctgggatggacaagagggactatgtatga

KEGG   Miniopterus natalensis: 107539888
Entry
107539888         CDS       T05883                                 

Gene name
CLDN17
Definition
(RefSeq) claudin-17
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107539888 (CLDN17)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107539888 (CLDN17)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107539888 (CLDN17)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107539888 (CLDN17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107539888 (CLDN17)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107539888 (CLDN17)
  Exosomal proteins of colorectal cancer cells
   107539888 (CLDN17)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like Claudin_3 DUF4064
Other DBs
NCBI-GeneID: 107539888
NCBI-ProteinID: XP_016071975
LinkDB
Position
Unknown
AA seq 226 aa
MAFYPLQVAGLVLGFVGTLGTLATTLLPQWRVSAFVGSNIIVFERIWEGLWMNCIRQAKV
TLQCKFYSSLLALPPVLEAARALMCVAVALSVVALLVGVCGMKQVRCTGSNQRAKAYLLG
ASGVLFILTGILVLIPVSWTANIIIRDFYNPAVHVGQKRELGAALFLGWTSAAVLSVGGG
LLCGFCCCNRKERGLRYPAPGYCVPPTGPRGAGAAAVPRKPSTSYV
NT seq 681 nt   +upstreamnt  +downstreamnt
atggccttctaccccctgcaggtggccgggctggttctcgggttcgtgggcacgctcggg
actcttgccaccacccttctgccccagtggcgggtgtcggcttttgtcggcagcaacatc
atcgtcttcgagaggatctgggaagggctgtggatgaactgcatccgacaggccaaggtc
accctgcagtgcaagttctacagctccttgctggccctgcccccggtcctggaggccgcc
cgggccctcatgtgcgtggccgtggctctctccgtggtcgctctgctcgtgggcgtctgt
ggcatgaagcaggtccggtgcacgggctcgaaccagagggccaaggcgtacctgctgggg
gcgtcgggggttctgttcatcctcacgggcatcctggtcctcattccggtgtcctggacg
gccaacatcatcatccgggatttctacaacccagccgtgcacgtgggccagaagcgggag
ctgggggcggcgctcttcctgggctggaccagcgccgccgtcctctccgtcggggggggt
ctgctctgcgggttctgctgctgcaacaggaaggagcgggggctccggtacccagccccc
gggtactgtgtgccccccacggggccgcgcggggccggggccgcggccgtgcccaggaag
ccctccaccagctacgtctag

KEGG   Miniopterus natalensis: 107541283
Entry
107541283         CDS       T05883                                 

Definition
(RefSeq) claudin-22-like
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107541283
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107541283
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107541283
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107541283
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107541283
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107541283
  Exosomal proteins of colorectal cancer cells
   107541283
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 107541283
NCBI-ProteinID: XP_016073788
LinkDB
Position
Unknown
AA seq 203 aa
MALVFRTVAQVTGISLSLLGWLLSCLTNYLPHWKNLNLELNEMENWTMGLWQACVIQEEG
GMECKDFDSFLALPAELRVSRILMFLSNGLGFLGLLLSGFGLDCLRIGEGLRERKKRLLI
LGGALLWMAGAAALVPVSWVAHVTVREFWDETIPEIVPRWEFGEALFIGWFAGSALLLGG
CLLNGAACSTQAPLASGHYTVAE
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctttagtatttaggactgtggcacaagtaactggaatttcactctctctgctggga
tggcttttatcctgtctcacaaactacctgccacattggaaaaacctcaacctggaatta
aatgaaatggaaaactggaccatgggactctggcaagcctgcgtcatccaggaggaaggc
gggatggagtgcaaggacttcgactctttcctggctctgccggccgagctcagggtctcc
cggattttaatgttcctgtccaacgggctggggtttctgggcctgctgctctctgggttt
gggctggactgcctgagaatcggagaggggctgcgggagcgcaagaagcgactgctgatc
ctgggaggagccctgctctggatggcaggcgcggcggccctggtgccggtgtcctgggtc
gcccacgtgaccgtgcgggagttctgggacgagaccatcccagagattgtgccccgctgg
gagtttggggaagccctcttcatcggctggtttgccgggtcggccctcctcctggggggg
tgcctgctgaacggggccgcctgctccacccaagctcctctggcttcgggccactacacg
gtggcagaa

KEGG   Miniopterus natalensis: 107541286
Entry
107541286         CDS       T05883                                 

Definition
(RefSeq) putative claudin-24
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107541286
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107541286
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107541286
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107541286
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107541286
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107541286
  Exosomal proteins of colorectal cancer cells
   107541286
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 107541286
NCBI-ProteinID: XP_016073791
LinkDB
Position
Unknown
AA seq 220 aa
MALVLRVVMQLVGLLLSLLGWVLSIVTTYLPHWKNLNLELNEMENWTMGLWQACVIQEEG
GMECKDFDSFLALPAELRVSRILMFLSNGLGFLGLLLSGFGLDCLRIGEGLRERKKRLLI
LGGALLWMAGAAALVPVSWVAHVTVREFWDETIPEIVPRWEFGEALFIGWFAGSALLLGG
CLLNGAACCTQAPLASGHYTVAETQSQCAYLENGTADPKV
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcgttagtcttgagagtagtaatgcaacttgttgggctgttattatctctgctggga
tgggttttgtccattgttacaacctacctgccacattggaaaaacctcaacctggaatta
aatgaaatggaaaactggaccatgggactctggcaagcctgcgtcatccaggaggaaggc
gggatggagtgcaaggacttcgactctttcctggctctgccggccgagctcagggtctcc
cggattttaatgttcctgtccaacgggctggggtttctgggcctgctgctctctgggttt
gggctggactgcctgagaatcggagaggggctgcgggagcgcaagaagcgactgctgatc
ctgggaggagccctgctctggatggcaggcgcggcggccctggtgccggtgtcctgggtc
gcccacgtgaccgtgcgggagttctgggacgagaccatcccagagattgtgccccgctgg
gagtttggggaagccctcttcatcggctggtttgccgggtcggccctcctcctggggggg
tgcctgctgaacggggccgcctgctgcacccaagctcctctggcttcgggccactacacg
gtggcagaaacacaaagtcagtgtgcctacctggaaaatgggactgcagatccgaaagtg
tga

KEGG   Miniopterus natalensis: 107541287
Entry
107541287         CDS       T05883                                 

Definition
(RefSeq) claudin-22-like
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107541287
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107541287
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107541287
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107541287
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107541287
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107541287
  Exosomal proteins of colorectal cancer cells
   107541287
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 107541287
NCBI-ProteinID: XP_016073792
LinkDB
Position
Unknown
AA seq 220 aa
MALVLRVVMQLVGLLLSLLGWVLSIVTTYLPHWKNLNLELNEMENWTMGLWQACVIQEEG
GMECKDFDSFLALPAELRVSRILMFLSNGLGFLGLLLSGFGLDCLRIGEGLRERKKRLLI
LGGALLWMAGAAALVPVSWVAHVTVREFWDETIPEIVPRWEFGEALFIGWFAGSALLLGG
CLLNGAACSTQAPLASGHYTVAETQYLHQHLEMANTHLTA
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcgttagtcttgagagtagtaatgcaacttgttgggctgttattatctctgctggga
tgggttttgtccattgttacaacctacctgccacattggaaaaacctcaacctggaatta
aatgaaatggaaaactggaccatgggactctggcaagcctgcgtcatccaggaggaaggc
gggatggagtgcaaggacttcgactctttcctggctctgccggccgagctcagggtctcc
cggattttaatgttcctgtccaacgggctggggtttctgggcctgctgctctctgggttt
gggctggactgcctgagaatcggagaggggctgcgggagcgcaagaagcgactgctgatc
ctgggaggagccctgctctggatggcaggcgcggcggccctggtgccggtgtcctgggtc
gcccacgtgaccgtgcgggagttctgggacgagaccatcccagagattgtgccccgctgg
gagtttggggaagccctcttcatcggctggtttgccgggtcggccctcctcctggggggg
tgcctgctgaacggggccgcctgctccacccaagctcctctggcttcgggccactacacg
gtggcagaaacgcagtatctccatcagcacctggagatggcaaacacccacctgacagcc
tga

KEGG   Miniopterus natalensis: 107543691
Entry
107543691         CDS       T05883                                 

Gene name
CLDN14
Definition
(RefSeq) claudin-14
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107543691 (CLDN14)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107543691 (CLDN14)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107543691 (CLDN14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107543691 (CLDN14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107543691 (CLDN14)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107543691 (CLDN14)
  Exosomal proteins of colorectal cancer cells
   107543691 (CLDN14)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Colicin_V
Other DBs
NCBI-GeneID: 107543691
NCBI-ProteinID: XP_016076761
LinkDB
Position
Unknown
AA seq 239 aa
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG
IYQCQVYRSLLALPQDLQAARALMVISCLLSGAACACAVIGMKCTRCAKGTPAKATFAVL
GGVLFLLGGLLCMVAVSWTTHDVVQNFYNPLLPSSMKFEIGQALYLGFISSSLSLIGGTL
LCLSCQDEAPSRPYQAQPRAATATAATAPSYRPPAAFKDNRAPSVTSASYSGYRLNDYV
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccagcacggccgtgcagctgctgggcttcctgctcagcttcctgggcatggtgggc
acgctcatcaccaccatcctgccgcactggcgcaggacggcgcacgtgggcaccaacatc
ctgacggccgtgtcctacctgaaggggctgtggatggagtgcgtgtggcacagcacgggc
atctaccagtgccaggtgtaccgctcgctgctggcgctgccccaggacctgcaggcggcg
cgcgcgctcatggtcatctcctgcctgctgtcgggcgcggcctgcgcctgcgccgtcatc
ggcatgaagtgcacgcgctgcgccaagggcacgccggccaaggccacgttcgccgtgctg
ggcggggtgctcttcctcctgggcggcctgctctgcatggtggccgtgtcctggaccacc
cacgacgtggtgcagaacttctacaacccgctgctgcccagcagcatgaagttcgagatc
gggcaggccctgtacctcggcttcatctcctcctccctgtcgctcatcggcggcaccctg
ctctgcctgtcctgccaggacgaggcgccctccaggccctaccaggcccagcccagggcc
gccactgccaccgcggccaccgcgccctcctaccggccgcccgccgccttcaaggacaac
cgggccccgtctgtcacctcggcctcttacagcgggtacaggctaaacgactatgtgtga

KEGG   Miniopterus natalensis: 107544613
Entry
107544613         CDS       T05883                                 

Gene name
CLDN7
Definition
(RefSeq) claudin-7
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107544613 (CLDN7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107544613 (CLDN7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107544613 (CLDN7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107544613 (CLDN7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107544613 (CLDN7)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107544613 (CLDN7)
  Exosomal proteins of colorectal cancer cells
   107544613 (CLDN7)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF1129 Clc-like SUR7 OppC_N
Other DBs
NCBI-GeneID: 107544613
NCBI-ProteinID: XP_016078032
LinkDB
Position
Unknown
AA seq 211 aa
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSFAGDNIITAQAMYKGLWMDCVTQSTG
VMSCKMYDSVLALPAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM
TGGIIFIVAGLAALIACSWYGHMIITDFYNPLVPMNVKYEFGPAIFIGWAGSALVLLGGA
LLSCSCPGSETKAGYGAPRSYPKPNSAKEYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaactcgggcctgcagctgctgggcttctccatggccttgctgggctgggtgggc
ctggtggcgtgcaccgccatcccgcagtggcagatgagctcgttcgcgggcgacaacatc
atcacggcccaggccatgtacaaggggctgtggatggactgcgtcactcagagcacggga
gtgatgagctgcaaaatgtacgactcggtgctcgccctgcctgcggcccttcaggccact
agagccctaatggtggtgtccctggtgctgggcttcctggccatgttcgtggccacgatg
ggcatgaagtgtacgcgctgtgggggagatgacaaagtgaagaaggcccgcatagccatg
accggaggcatcattttcatcgtggcaggtcttgctgctttgatagcttgctcctggtat
ggccacatgattatcacagacttttataaccctttggtccccatgaatgttaagtacgag
tttggtcctgccatcttcattggctgggcagggtctgctctggtccttttgggaggtgca
ctgctctcttgctcctgtcctgggagtgagacaaaagctgggtacggtgcaccccgctcc
taccctaagcccaactctgccaaggagtacgtgtga

KEGG   Miniopterus natalensis: 107545903
Entry
107545903         CDS       T05883                                 

Gene name
CLDN10
Definition
(RefSeq) claudin-10 isoform X1
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107545903 (CLDN10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107545903 (CLDN10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107545903 (CLDN10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107545903 (CLDN10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545903 (CLDN10)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107545903 (CLDN10)
  Exosomal proteins of colorectal cancer cells
   107545903 (CLDN10)
SSDB
Motif
Pfam: PMP22_Claudin
Other DBs
NCBI-GeneID: 107545903
NCBI-ProteinID: XP_016079638
LinkDB
Position
Unknown
AA seq 297 aa
MASTALEIIAFTVSISGWLLVSSTVPTDYWKVSTNDGTVITTATFWANLWKTCVTDSTGV
SSCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIIALFGMKCTKVGGSEKAKAKIACLA
GVVFILSGLCSMTGCSLYANKITTEFFDPLFVDQNLRVSYPHGIVFCFSSPVRKSPSLPV
CPAFWSLSFYHPPTSPPALSLSFSHPGYPRLLLQDLHSGGGPPGCCSCTSRFYHNPAGQL
ALAYWCSSQSRPGASQNGDGILLIGGVSAASPCSTFTARMVSQQCCVTVCLSASFLE
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcgagcacggccttggagatcatcgcgttcaccgtctctatctcgggctggttgctg
gtctcttccacggtgcccaccgactactggaaggtgtccaccaacgacggcacggtcatc
accaccgccaccttttgggccaacctgtggaagacatgcgttaccgactccacgggcgtc
tccagctgcaaggacttcccctccatgctggcgctggacggttatatccaggcctgtaga
ggacttatgattgccgctgtcagcctgggcttttttggttccataattgccctgtttgga
atgaagtgtaccaaagtcggaggctcagagaaagccaaagctaaaatcgcttgtttggct
ggggttgtgttcatactgtcagggctatgctcaatgaccggctgttccctgtacgcgaac
aaaatcacaacggaattcttcgatcctctgtttgttgatcaaaatctcagagtttcttat
cctcacggaattgtgttttgtttttcctcaccagtaaggaagtccccatccctgccagta
tgccctgctttctggtcactcagcttctaccacccccccacctcccctccagccctttcc
ctctccttttcacatcctggctaccctcggcttctcctgcaggacttgcattctggtggg
ggtccgcctggctgctgctcttgcacctcacgcttctatcataatcctgctgggcaatta
gcacttgcttattggtgcagctctcagagcagaccaggagcatctcaaaacggagacggc
atcttgctgattggtggagtctctgcagctagtccatgttccacatttacagcaaggatg
gtcagtcagcagtgctgtgtgactgtctgtctgtctgcatctttcctggagtag

KEGG   Miniopterus natalensis: 107546080
Entry
107546080         CDS       T05883                                 

Gene name
CLDN18
Definition
(RefSeq) claudin-18 isoform X1
  KO
K06087  claudin
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107546080 (CLDN18)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107546080 (CLDN18)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107546080 (CLDN18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107546080 (CLDN18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107546080 (CLDN18)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   107546080 (CLDN18)
  Exosomal proteins of colorectal cancer cells
   107546080 (CLDN18)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin
Other DBs
NCBI-GeneID: 107546080
NCBI-ProteinID: XP_016079817
LinkDB
Position
Unknown
AA seq 261 aa
MSTTTCQVVGFLLSMLGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVKQSSGF
TECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGTMEDSAKANMTLT
SGIMFIISGLCAIAGVSVFANMLVTNFWMSTANMYSGMGGMVQTVQTRYTFGSALFVGWV
AGGLTLIGGVMMCIACRGLAPEETTYKAVSYHASGHNVAYKTGGFKASTGFGPNTKNKKI
YEGGAHIEDEVQSHPSKYDYV
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtccaccaccacgtgccaagtggtgggcttcctcctgtccatgctgggcctggcgggc
tgcatcgcagccacggggatggacatgtggagcacccaggacctgtacgacaacccggtc
acctcggtgttccagtacgaagggctctggaggagctgcgtgaagcagagctcagggttc
accgaatgccggccctacttcaccatcctgggccttccagccatgctgcaggcggtgcga
gccctgatgattgtgggcattgtcctgggtgccattggcctcctggtgtccatctttgcc
ctgaagtgcatccgcattggcaccatggaggactccgccaaagccaacatgacactgacc
tccggaatcatgttcattatctcaggtctctgtgcaatcgctggagtgtctgtgtttgcc
aacatgctggtgactaacttctggatgtctacagctaacatgtactccggcatgggtggg
atggtgcagactgttcaaaccaggtacacctttggttcggctctgttcgtgggctgggtc
gctggaggcctcacgctaattgggggcgtgatgatgtgcattgcctgccggggcctggcg
cccgaggaaaccacctacaaagctgtgtcttatcatgcctcgggccacaatgtcgcctac
aagaccggaggcttcaaggccagcactggctttgggcccaacaccaaaaacaagaagata
tatgaggggggtgcccacatagaggacgaagtacaatctcatccttccaagtatgactac
gtgtag

DBGET integrated database retrieval system