KEGG   Miniopterus natalensis: 107526728
Entry
107526728         CDS       T05883                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04926  Relaxin signaling pathway
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05100  Bacterial invasion of epithelial cells
mna05135  Yersinia infection
mna05142  Chagas disease
mna05146  Amoebiasis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05415  Diabetic cardiomyopathy
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107526728 (PIK3R3)
   04014 Ras signaling pathway
    107526728 (PIK3R3)
   04015 Rap1 signaling pathway
    107526728 (PIK3R3)
   04370 VEGF signaling pathway
    107526728 (PIK3R3)
   04630 JAK-STAT signaling pathway
    107526728 (PIK3R3)
   04668 TNF signaling pathway
    107526728 (PIK3R3)
   04066 HIF-1 signaling pathway
    107526728 (PIK3R3)
   04068 FoxO signaling pathway
    107526728 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    107526728 (PIK3R3)
   04072 Phospholipase D signaling pathway
    107526728 (PIK3R3)
   04071 Sphingolipid signaling pathway
    107526728 (PIK3R3)
   04024 cAMP signaling pathway
    107526728 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    107526728 (PIK3R3)
   04152 AMPK signaling pathway
    107526728 (PIK3R3)
   04150 mTOR signaling pathway
    107526728 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107526728 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    107526728 (PIK3R3)
   04218 Cellular senescence
    107526728 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107526728 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    107526728 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107526728 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107526728 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    107526728 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    107526728 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    107526728 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    107526728 (PIK3R3)
   04660 T cell receptor signaling pathway
    107526728 (PIK3R3)
   04662 B cell receptor signaling pathway
    107526728 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    107526728 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    107526728 (PIK3R3)
   04670 Leukocyte transendothelial migration
    107526728 (PIK3R3)
   04062 Chemokine signaling pathway
    107526728 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107526728 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    107526728 (PIK3R3)
   04929 GnRH secretion
    107526728 (PIK3R3)
   04915 Estrogen signaling pathway
    107526728 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    107526728 (PIK3R3)
   04917 Prolactin signaling pathway
    107526728 (PIK3R3)
   04926 Relaxin signaling pathway
    107526728 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    107526728 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    107526728 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107526728 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107526728 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    107526728 (PIK3R3)
   04722 Neurotrophin signaling pathway
    107526728 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107526728 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    107526728 (PIK3R3)
   04380 Osteoclast differentiation
    107526728 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    107526728 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    107526728 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107526728 (PIK3R3)
   05206 MicroRNAs in cancer
    107526728 (PIK3R3)
   05205 Proteoglycans in cancer
    107526728 (PIK3R3)
   05207 Chemical carcinogenesis - receptor activation
    107526728 (PIK3R3)
   05203 Viral carcinogenesis
    107526728 (PIK3R3)
   05230 Central carbon metabolism in cancer
    107526728 (PIK3R3)
   05231 Choline metabolism in cancer
    107526728 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107526728 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107526728 (PIK3R3)
   05212 Pancreatic cancer
    107526728 (PIK3R3)
   05225 Hepatocellular carcinoma
    107526728 (PIK3R3)
   05226 Gastric cancer
    107526728 (PIK3R3)
   05214 Glioma
    107526728 (PIK3R3)
   05221 Acute myeloid leukemia
    107526728 (PIK3R3)
   05220 Chronic myeloid leukemia
    107526728 (PIK3R3)
   05218 Melanoma
    107526728 (PIK3R3)
   05211 Renal cell carcinoma
    107526728 (PIK3R3)
   05215 Prostate cancer
    107526728 (PIK3R3)
   05213 Endometrial cancer
    107526728 (PIK3R3)
   05224 Breast cancer
    107526728 (PIK3R3)
   05222 Small cell lung cancer
    107526728 (PIK3R3)
   05223 Non-small cell lung cancer
    107526728 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107526728 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    107526728 (PIK3R3)
   05161 Hepatitis B
    107526728 (PIK3R3)
   05160 Hepatitis C
    107526728 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    107526728 (PIK3R3)
   05164 Influenza A
    107526728 (PIK3R3)
   05162 Measles
    107526728 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    107526728 (PIK3R3)
   05163 Human cytomegalovirus infection
    107526728 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107526728 (PIK3R3)
   05169 Epstein-Barr virus infection
    107526728 (PIK3R3)
   05165 Human papillomavirus infection
    107526728 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107526728 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    107526728 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107526728 (PIK3R3)
   05142 Chagas disease
    107526728 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107526728 (PIK3R3)
   05017 Spinocerebellar ataxia
    107526728 (PIK3R3)
   05020 Prion disease
    107526728 (PIK3R3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107526728 (PIK3R3)
   05418 Fluid shear stress and atherosclerosis
    107526728 (PIK3R3)
   05415 Diabetic cardiomyopathy
    107526728 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107526728 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    107526728 (PIK3R3)
   04931 Insulin resistance
    107526728 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107526728 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107526728 (PIK3R3)
   01524 Platinum drug resistance
    107526728 (PIK3R3)
   01522 Endocrine resistance
    107526728 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107526728 (PIK3R3)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107526728 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 PI_PP_I DUF4806
Other DBs
NCBI-GeneID: 107526728
NCBI-ProteinID: XP_016054761
LinkDB
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSPVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSKYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQYRKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINDEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSFCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaataccgtgtggagtatggaccgcgatgacgcagactggagggaagtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcacctgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattaagg
gacatgccagatggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattat
actttgactttacggaaaggaggcaataataagttaataaagatctatcatcgagatggt
aaatatggcttttctgaccctctgacatttaattctgtggtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccaaataccaacaggatcagttggtaaaagaagataatattgatgcagtaggtaaaaaa
ctgcaggagtaccattctcagtatcaggaaaagagtaaagagtatgacaggctatatgaa
gaatataccagaacatcccaggaaatacagatgaagcggactgcaattgaagcctttaat
gaaacaattaaaatatttgaagagcagtgtcacacgcaagaacaatatcgcaaagaatat
attgagcgatttcgcagggagggaaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgcctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgcaagatccgtgatcaacatcttgtatggctcaatcacaaagga
gtgagacagaaacgcctaaatgcctggctaggaatcaagaatgaggatgctgatgagacc
tattttatcaatgatgaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaagatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattc
ttaattcgcgagagtagcaagaaaggatgttatgcttgctctgtggttgccgatggggaa
gtgaagcattgtgtgatctacagcactgcccggggctatggctttgcagagccctacaac
ctgtacagctcactgaaggagctggtgctccactaccagcagacatccctcgttcagcac
aacgactccctcaacgtcaggcttgcctatcctgtccatgcacagatgccctcattctgc
agataa

KEGG   Miniopterus natalensis: 107529317
Entry
107529317         CDS       T05883                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04926  Relaxin signaling pathway
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05100  Bacterial invasion of epithelial cells
mna05135  Yersinia infection
mna05142  Chagas disease
mna05146  Amoebiasis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05415  Diabetic cardiomyopathy
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107529317 (PIK3R1)
   04014 Ras signaling pathway
    107529317 (PIK3R1)
   04015 Rap1 signaling pathway
    107529317 (PIK3R1)
   04370 VEGF signaling pathway
    107529317 (PIK3R1)
   04630 JAK-STAT signaling pathway
    107529317 (PIK3R1)
   04668 TNF signaling pathway
    107529317 (PIK3R1)
   04066 HIF-1 signaling pathway
    107529317 (PIK3R1)
   04068 FoxO signaling pathway
    107529317 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    107529317 (PIK3R1)
   04072 Phospholipase D signaling pathway
    107529317 (PIK3R1)
   04071 Sphingolipid signaling pathway
    107529317 (PIK3R1)
   04024 cAMP signaling pathway
    107529317 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    107529317 (PIK3R1)
   04152 AMPK signaling pathway
    107529317 (PIK3R1)
   04150 mTOR signaling pathway
    107529317 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107529317 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    107529317 (PIK3R1)
   04218 Cellular senescence
    107529317 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107529317 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107529317 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107529317 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107529317 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    107529317 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    107529317 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    107529317 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    107529317 (PIK3R1)
   04660 T cell receptor signaling pathway
    107529317 (PIK3R1)
   04662 B cell receptor signaling pathway
    107529317 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    107529317 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    107529317 (PIK3R1)
   04670 Leukocyte transendothelial migration
    107529317 (PIK3R1)
   04062 Chemokine signaling pathway
    107529317 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107529317 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    107529317 (PIK3R1)
   04929 GnRH secretion
    107529317 (PIK3R1)
   04915 Estrogen signaling pathway
    107529317 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    107529317 (PIK3R1)
   04917 Prolactin signaling pathway
    107529317 (PIK3R1)
   04926 Relaxin signaling pathway
    107529317 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    107529317 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    107529317 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107529317 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107529317 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    107529317 (PIK3R1)
   04722 Neurotrophin signaling pathway
    107529317 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107529317 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    107529317 (PIK3R1)
   04380 Osteoclast differentiation
    107529317 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    107529317 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    107529317 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107529317 (PIK3R1)
   05206 MicroRNAs in cancer
    107529317 (PIK3R1)
   05205 Proteoglycans in cancer
    107529317 (PIK3R1)
   05207 Chemical carcinogenesis - receptor activation
    107529317 (PIK3R1)
   05203 Viral carcinogenesis
    107529317 (PIK3R1)
   05230 Central carbon metabolism in cancer
    107529317 (PIK3R1)
   05231 Choline metabolism in cancer
    107529317 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107529317 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107529317 (PIK3R1)
   05212 Pancreatic cancer
    107529317 (PIK3R1)
   05225 Hepatocellular carcinoma
    107529317 (PIK3R1)
   05226 Gastric cancer
    107529317 (PIK3R1)
   05214 Glioma
    107529317 (PIK3R1)
   05221 Acute myeloid leukemia
    107529317 (PIK3R1)
   05220 Chronic myeloid leukemia
    107529317 (PIK3R1)
   05218 Melanoma
    107529317 (PIK3R1)
   05211 Renal cell carcinoma
    107529317 (PIK3R1)
   05215 Prostate cancer
    107529317 (PIK3R1)
   05213 Endometrial cancer
    107529317 (PIK3R1)
   05224 Breast cancer
    107529317 (PIK3R1)
   05222 Small cell lung cancer
    107529317 (PIK3R1)
   05223 Non-small cell lung cancer
    107529317 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107529317 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    107529317 (PIK3R1)
   05161 Hepatitis B
    107529317 (PIK3R1)
   05160 Hepatitis C
    107529317 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    107529317 (PIK3R1)
   05164 Influenza A
    107529317 (PIK3R1)
   05162 Measles
    107529317 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    107529317 (PIK3R1)
   05163 Human cytomegalovirus infection
    107529317 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107529317 (PIK3R1)
   05169 Epstein-Barr virus infection
    107529317 (PIK3R1)
   05165 Human papillomavirus infection
    107529317 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107529317 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    107529317 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107529317 (PIK3R1)
   05142 Chagas disease
    107529317 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107529317 (PIK3R1)
   05017 Spinocerebellar ataxia
    107529317 (PIK3R1)
   05020 Prion disease
    107529317 (PIK3R1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107529317 (PIK3R1)
   05418 Fluid shear stress and atherosclerosis
    107529317 (PIK3R1)
   05415 Diabetic cardiomyopathy
    107529317 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107529317 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    107529317 (PIK3R1)
   04931 Insulin resistance
    107529317 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107529317 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107529317 (PIK3R1)
   01524 Platinum drug resistance
    107529317 (PIK3R1)
   01522 Endocrine resistance
    107529317 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107529317 (PIK3R1)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107529317 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 DUF4201 SH3_2 SH3_9 Laminin_I PI_PP_I ACDC Bap31_Bap29_C Mod_r
Other DBs
NCBI-GeneID: 107529317
NCBI-ProteinID: XP_016058161
LinkDB
Position
Unknown
AA seq 724 aa
MSAEGFQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEAESEQQALTLPDLAE
QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASMDLETVDVQ
VLADAFKRYLLELPNPVIPVAVYSEMVSLAQEVQSSEEYIQLLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQSSSKNLLTARVLSELFSPLLFRFPAASSENTEHLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKRQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRSKAENLLRGKRDGTFLVRESSKPGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgccgaggggttccagtaccgagccctctatgactataaaaaggagcgagaagaa
gacattgacttgcacttgggtgacatattgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggctataat
gaaaccacaggggagagaggagactttccaggaacttatgtagaatatattggaaggaaa
aaaatctcacctcccaccccaaagccccggccacctcgaccccttcctgttgcaccaggt
tcttcaaaaactgaagcggaaagtgagcaacaagctttgacccttccggatcttgcagaa
cagtttgcccctcctgatatcgctccaccccttcttatcaagctagtagaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagcagag
ttacgacagcttcttgattgtgatgccgcctccatggacttggaaacagttgatgttcaa
gttttagcagatgctttcaaacgctatctgttggagctaccaaatcccgtcattccagta
gctgtttacagtgaaatggtttctttagcccaagaagtacagagttcggaagaatatatc
cagctgctgaagaagctcattaggtcacctaacatacctcatcagtattggcttacgctg
cagtatttgctcaaacatttcttcaagctctcccaaagctccagcaagaatctcttgact
gcaagagtgctctctgagcttttcagccctctgctcttcagattcccagcagccagctct
gagaatactgaacacctcataaaagttatagaaattttaatctcaacggaatggaacgaa
cgacagcccgcaccagcactgcctcctaaaccaccaaaacccactactgtggccaacaac
ggtatgaataacaatatgtccttgcaagatgctgagtggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagatacagctgacgggacctttttggtacgagacgca
tctactaaaatgcatggtgattatactctcacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctcggacccattaaccttcaactct
gtggttgaattgataaaccactaccggaatgagtctctagctcagtacaatcccaagctg
gatgtgaagctgctttatccagtgtccaaataccaacaggatcaggttgtcaaagaagat
aatattgaagctgtaggaaaaaaattacatgaatataacactcaatttcaagaaaaaagt
cgggaatatgatagattatacgaggattatacccgcacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaacgaaaccataaagatatttgaagaacagtgccaaacc
caggagcgctacagcaaagaatacatagaaaagtttaaacgtgaaggcaatgagaaagaa
atccaaaggattatgcataattatgaaaagttaaagtctcgaatcagtgaaatcgtggac
agcagacggcggctggaggaggacttgaagcggcaggcggccgagtaccgggagatcgac
aagcgcatgaacagcatcaagcccgacctcatccagctgaggaagacgagggaccagtac
ctgatgtggttgactcagaaaggtgtgcggcagaagaagttgaacgagtggctgggcaat
gagaacaccgaggaccaatactcgctggtggaggacgacgaggacctgccccaccacgat
gagaagacctggaacgtggggagcagcaaccggagcaaggctgagaacctgctgcgtggg
aagcgggacggcactttcctggtccgggagagcagtaagcccggctgctacgcctgctct
gtcgtggtggatggcgaggtgaagcactgtgtcatcaacaagacggcgaccggctacggc
tttgccgagccctacaacctgtacagctccctgaaggagctggtgctacattaccaacac
acctccctcgtgcagcacaacgactccctcaacgtcacgctggcctacccggtgtacgca
cagcagaggcgatga

KEGG   Miniopterus natalensis: 107532628
Entry
107532628         CDS       T05883                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04926  Relaxin signaling pathway
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05100  Bacterial invasion of epithelial cells
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05146  Amoebiasis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05415  Diabetic cardiomyopathy
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107532628 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107532628 (PIK3CB)
   04014 Ras signaling pathway
    107532628 (PIK3CB)
   04015 Rap1 signaling pathway
    107532628 (PIK3CB)
   04370 VEGF signaling pathway
    107532628 (PIK3CB)
   04630 JAK-STAT signaling pathway
    107532628 (PIK3CB)
   04668 TNF signaling pathway
    107532628 (PIK3CB)
   04066 HIF-1 signaling pathway
    107532628 (PIK3CB)
   04068 FoxO signaling pathway
    107532628 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    107532628 (PIK3CB)
   04072 Phospholipase D signaling pathway
    107532628 (PIK3CB)
   04071 Sphingolipid signaling pathway
    107532628 (PIK3CB)
   04024 cAMP signaling pathway
    107532628 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    107532628 (PIK3CB)
   04152 AMPK signaling pathway
    107532628 (PIK3CB)
   04150 mTOR signaling pathway
    107532628 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107532628 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    107532628 (PIK3CB)
   04218 Cellular senescence
    107532628 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107532628 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    107532628 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107532628 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107532628 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    107532628 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    107532628 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    107532628 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    107532628 (PIK3CB)
   04660 T cell receptor signaling pathway
    107532628 (PIK3CB)
   04662 B cell receptor signaling pathway
    107532628 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    107532628 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    107532628 (PIK3CB)
   04670 Leukocyte transendothelial migration
    107532628 (PIK3CB)
   04062 Chemokine signaling pathway
    107532628 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107532628 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    107532628 (PIK3CB)
   04929 GnRH secretion
    107532628 (PIK3CB)
   04915 Estrogen signaling pathway
    107532628 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    107532628 (PIK3CB)
   04917 Prolactin signaling pathway
    107532628 (PIK3CB)
   04926 Relaxin signaling pathway
    107532628 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    107532628 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    107532628 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107532628 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107532628 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    107532628 (PIK3CB)
   04722 Neurotrophin signaling pathway
    107532628 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107532628 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    107532628 (PIK3CB)
   04380 Osteoclast differentiation
    107532628 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    107532628 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    107532628 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532628 (PIK3CB)
   05206 MicroRNAs in cancer
    107532628 (PIK3CB)
   05205 Proteoglycans in cancer
    107532628 (PIK3CB)
   05207 Chemical carcinogenesis - receptor activation
    107532628 (PIK3CB)
   05203 Viral carcinogenesis
    107532628 (PIK3CB)
   05230 Central carbon metabolism in cancer
    107532628 (PIK3CB)
   05231 Choline metabolism in cancer
    107532628 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107532628 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107532628 (PIK3CB)
   05212 Pancreatic cancer
    107532628 (PIK3CB)
   05225 Hepatocellular carcinoma
    107532628 (PIK3CB)
   05226 Gastric cancer
    107532628 (PIK3CB)
   05214 Glioma
    107532628 (PIK3CB)
   05221 Acute myeloid leukemia
    107532628 (PIK3CB)
   05220 Chronic myeloid leukemia
    107532628 (PIK3CB)
   05218 Melanoma
    107532628 (PIK3CB)
   05211 Renal cell carcinoma
    107532628 (PIK3CB)
   05215 Prostate cancer
    107532628 (PIK3CB)
   05213 Endometrial cancer
    107532628 (PIK3CB)
   05224 Breast cancer
    107532628 (PIK3CB)
   05222 Small cell lung cancer
    107532628 (PIK3CB)
   05223 Non-small cell lung cancer
    107532628 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107532628 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    107532628 (PIK3CB)
   05161 Hepatitis B
    107532628 (PIK3CB)
   05160 Hepatitis C
    107532628 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    107532628 (PIK3CB)
   05164 Influenza A
    107532628 (PIK3CB)
   05162 Measles
    107532628 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    107532628 (PIK3CB)
   05163 Human cytomegalovirus infection
    107532628 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107532628 (PIK3CB)
   05169 Epstein-Barr virus infection
    107532628 (PIK3CB)
   05165 Human papillomavirus infection
    107532628 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107532628 (PIK3CB)
   05135 Yersinia infection
    107532628 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    107532628 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107532628 (PIK3CB)
   05142 Chagas disease
    107532628 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107532628 (PIK3CB)
   05017 Spinocerebellar ataxia
    107532628 (PIK3CB)
   05020 Prion disease
    107532628 (PIK3CB)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107532628 (PIK3CB)
   05418 Fluid shear stress and atherosclerosis
    107532628 (PIK3CB)
   05415 Diabetic cardiomyopathy
    107532628 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107532628 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    107532628 (PIK3CB)
   04931 Insulin resistance
    107532628 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107532628 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107532628 (PIK3CB)
   01524 Platinum drug resistance
    107532628 (PIK3CB)
   01522 Endocrine resistance
    107532628 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107532628 (PIK3CB)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107532628 (PIK3CB)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107532628 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381 DUF4135
Other DBs
NCBI-GeneID: 107532628
NCBI-ProteinID: XP_016062554
LinkDB
Position
Unknown
AA seq 1069 aa
MCFNFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
TQIHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
DPSLLENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
ISPYDYVLQISGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKRIISHVWENNSPFQIVLVKGNKLNTEETVKVHVRAGLFHGT
ELLCKTIVSSEISGKSDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTIN
ASKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQT
NPYTENATALYIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKEI
LDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKL
PPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLL
ERALANRRIGQFLFWHLRSEVHIPAISIQFGVILEAYCRGSVGHMKVLSKQVEALNKLKT
LNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMDS
KMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGC
LATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEF
TLSCAGYCVASYVLGIGDRHSDNIMVKKNGQLFHIDFGHILGNFKSKFGIKRERVPFILT
YDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDI
QYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgtgcttcaatttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagatagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaaacagatgttgtgg
acacagattcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagctgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcggaaattcagtgaggaaaagatt
cagtcacttgtgggattgtcttggatggactggctaaagcaaacatatccaccggagcat
gatccatccctccttgaaaacttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtgtctcctaatatgaatcct
atcaaagtaaatgaattggcaatccagaaacgtttgactattcacgggaaggaggatgaa
atcagtccctatgactacgtgttgcaaatcagcgggagagtagaatatgtgtttggcgat
cacccgctaatccagttccagtatatccggaactgtgttatgaacaggaccttgccccat
tttatacttgtggaatgttgcaagatcaaaaagatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaacga
attatttctcatgtttgggaaaataacagtcctttccaaattgtcttggttaagggaaat
aaacttaacacagaagaaactgtaaaggttcatgtcagggctggcctttttcatggtact
gaactcctgtgtaaaaccatcgtaagctcagagatatcagggaaaagtgatcatatttgg
aatgaaccactggaatttgatattaatacttgtgacctgccacgaatggctagattatgt
tttgctgtttatgcagttttggataaagtaaaaacaaagaaatcaactaaaacgattaat
gcctctaaatatcagactatcaggaaatccgggaaagtgcattatcctgtagcatgggta
aatacgatggtttttgacttcaaaggacagttgagatctggagacataatattgcacagc
tggtcttcatttcctgatgaacttgaagaaatgctgaatccaatgggaactgttcaaaca
aatccatatactgaaaatgcaacggctttatatatcaaattcccagagaataaaaaacaa
ccatattattaccctccctttgataagattatcgaaaaggcagctgagattgcaagcagc
gatagtgctaatgtatcaagtcggggtggaaaaaagtttcttgctgtactgaaggaaatc
ttggacagggatcccttgtctcaactgtgtgagaatgaaatggatcttatttggactttg
cggcaagactgcagagagaatttcccacagtcactgccaaaattattactgtcaatcaag
tggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaacta
cccccccgggaggccctggagcttctagatttcaactatccagatcagtatgttcgggaa
tatgctgtaggctgcctgcgacagatgagtgatgaagaactctcacagtatcttttacaa
ctggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattcctatta
gaaagagcacttgctaatcggaggatagggcagtttctattttggcaccttaggtcagaa
gtacacattcctgctatctccatacagtttggtgtcatccttgaagcttactgccgggga
agtgtagggcacatgaaagtgctttctaagcaggttgaagcactcaataaattaaaaact
ttaaatagtttaatcaaactgaatgcaatgaagttaaacagagccaaagggaaagaggcc
atgcacacttgtttaaaacagaacgcttaccgagaagccctctctgacctgcaatcacct
ctgaacccatgtgtcatcctctcagaactctatgttgaaaagtgtaaatacatggattct
aaaatgaagcctttgtggttggtgtacaacaacaaggtatttggtgaggattcagtcgga
gtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccaaatgctgcgc
ttaatggatttactctggaaagaagccggtctggatcttcggatgctaccttatggctgt
ttagccacaggagatcgctcaggcctcattgaagttgtgagcacctctgaaacaattgct
gacattcagctgaacagtagcaatgtggctgctgcagcagccttcaataaagatgccctt
ctgaactggcttaaagaatacaattctggagatgacctggaccgagccattgaggagttt
accctgtcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacagacat
agtgacaacattatggtaaaaaaaaacggccagctcttccacattgactttggacatatt
cttggaaattttaaatctaaatttggcattaaaagggagcgagtgccttttattcttact
tatgatttcattcatgtgattcaacaaggaaaaacaggaaacacggaaaaatttggccgg
ttccgccagtgttgtgaggatgcgtatctgattttgcgacgacacgggaatctcttcatc
actctctttgcactgatgttgactgcagggctccctgaactcacatcagtcaaggatata
cagtatcttaaggactcacttgccttagggaagagtgaagaagaagcactgaagcaattt
aagcagaaatttgatgaggcgctcagggaaagctggactactaaggtgaactggatggcc
cacacagttcggaaagactacagatcgtaa

KEGG   Miniopterus natalensis: 107535325
Entry
107535325         CDS       T05883                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04926  Relaxin signaling pathway
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05100  Bacterial invasion of epithelial cells
mna05135  Yersinia infection
mna05142  Chagas disease
mna05146  Amoebiasis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05415  Diabetic cardiomyopathy
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107535325 (PIK3R2)
   04014 Ras signaling pathway
    107535325 (PIK3R2)
   04015 Rap1 signaling pathway
    107535325 (PIK3R2)
   04370 VEGF signaling pathway
    107535325 (PIK3R2)
   04630 JAK-STAT signaling pathway
    107535325 (PIK3R2)
   04668 TNF signaling pathway
    107535325 (PIK3R2)
   04066 HIF-1 signaling pathway
    107535325 (PIK3R2)
   04068 FoxO signaling pathway
    107535325 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    107535325 (PIK3R2)
   04072 Phospholipase D signaling pathway
    107535325 (PIK3R2)
   04071 Sphingolipid signaling pathway
    107535325 (PIK3R2)
   04024 cAMP signaling pathway
    107535325 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    107535325 (PIK3R2)
   04152 AMPK signaling pathway
    107535325 (PIK3R2)
   04150 mTOR signaling pathway
    107535325 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107535325 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    107535325 (PIK3R2)
   04218 Cellular senescence
    107535325 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107535325 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    107535325 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107535325 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107535325 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    107535325 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    107535325 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    107535325 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    107535325 (PIK3R2)
   04660 T cell receptor signaling pathway
    107535325 (PIK3R2)
   04662 B cell receptor signaling pathway
    107535325 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    107535325 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    107535325 (PIK3R2)
   04670 Leukocyte transendothelial migration
    107535325 (PIK3R2)
   04062 Chemokine signaling pathway
    107535325 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107535325 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    107535325 (PIK3R2)
   04929 GnRH secretion
    107535325 (PIK3R2)
   04915 Estrogen signaling pathway
    107535325 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    107535325 (PIK3R2)
   04917 Prolactin signaling pathway
    107535325 (PIK3R2)
   04926 Relaxin signaling pathway
    107535325 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    107535325 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    107535325 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107535325 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107535325 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    107535325 (PIK3R2)
   04722 Neurotrophin signaling pathway
    107535325 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107535325 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    107535325 (PIK3R2)
   04380 Osteoclast differentiation
    107535325 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    107535325 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    107535325 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535325 (PIK3R2)
   05206 MicroRNAs in cancer
    107535325 (PIK3R2)
   05205 Proteoglycans in cancer
    107535325 (PIK3R2)
   05207 Chemical carcinogenesis - receptor activation
    107535325 (PIK3R2)
   05203 Viral carcinogenesis
    107535325 (PIK3R2)
   05230 Central carbon metabolism in cancer
    107535325 (PIK3R2)
   05231 Choline metabolism in cancer
    107535325 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107535325 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107535325 (PIK3R2)
   05212 Pancreatic cancer
    107535325 (PIK3R2)
   05225 Hepatocellular carcinoma
    107535325 (PIK3R2)
   05226 Gastric cancer
    107535325 (PIK3R2)
   05214 Glioma
    107535325 (PIK3R2)
   05221 Acute myeloid leukemia
    107535325 (PIK3R2)
   05220 Chronic myeloid leukemia
    107535325 (PIK3R2)
   05218 Melanoma
    107535325 (PIK3R2)
   05211 Renal cell carcinoma
    107535325 (PIK3R2)
   05215 Prostate cancer
    107535325 (PIK3R2)
   05213 Endometrial cancer
    107535325 (PIK3R2)
   05224 Breast cancer
    107535325 (PIK3R2)
   05222 Small cell lung cancer
    107535325 (PIK3R2)
   05223 Non-small cell lung cancer
    107535325 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107535325 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    107535325 (PIK3R2)
   05161 Hepatitis B
    107535325 (PIK3R2)
   05160 Hepatitis C
    107535325 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    107535325 (PIK3R2)
   05164 Influenza A
    107535325 (PIK3R2)
   05162 Measles
    107535325 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    107535325 (PIK3R2)
   05163 Human cytomegalovirus infection
    107535325 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107535325 (PIK3R2)
   05169 Epstein-Barr virus infection
    107535325 (PIK3R2)
   05165 Human papillomavirus infection
    107535325 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107535325 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    107535325 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107535325 (PIK3R2)
   05142 Chagas disease
    107535325 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107535325 (PIK3R2)
   05017 Spinocerebellar ataxia
    107535325 (PIK3R2)
   05020 Prion disease
    107535325 (PIK3R2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107535325 (PIK3R2)
   05418 Fluid shear stress and atherosclerosis
    107535325 (PIK3R2)
   05415 Diabetic cardiomyopathy
    107535325 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107535325 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    107535325 (PIK3R2)
   04931 Insulin resistance
    107535325 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107535325 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107535325 (PIK3R2)
   01524 Platinum drug resistance
    107535325 (PIK3R2)
   01522 Endocrine resistance
    107535325 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107535325 (PIK3R2)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107535325 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e
Other DBs
NCBI-GeneID: 107535325
NCBI-ProteinID: XP_016066219
LinkDB
Position
Unknown
AA seq 725 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGSERCPQNVGWMPGL
NERTRQRGDFPGTYVEFLGPVALTRPGPRPRGPRPLPARPREGPPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESLYRPELPPPCTDWSLSDLEQWDSAALADGIKGFLLA
LPAPLVTLEAAAEACCALREAAGPVGPTLEPPTLPLHHALTLRFLLQHLGRVARRAPAPR
SALRALGVAFGPLLLRAPPPSPPGVPPVGTEPNPDFPALLVEKLLQEHLEEQEVAPPALP
PKPPKVKPAPAGLANGGSQPSLQDAEWYWGDISREEVNDKLRDTPDGTFLVRDASSKIQG
EYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLY
PVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRSSQELQMKRTAIEA
FNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLE
QELRTQALDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETED
QYALMEDEDDLPHHEERTWYVGKINRTQAEEMLNGKRDGTFLIRESSQRGCYACSVVVDG
DTKHCVIYRTATGLGFAEPYNLYGSLKELVLHYQHTSLVQHNDALTVTLAHPVRAPGPGP
PPAAR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggctggcgctgagggcttccaataccgtgcactgtaccctttccgccgggagcggcca
gaggacctggagctgctgcctggcgacgtgctggtggtgagccgggctgccctgcaggtg
ctgggtgtggccgagggcagcgagcgctgcccacagaacgtgggctggatgcctggcctc
aatgagcgtactcggcagcgcggtgacttccctggtacctacgtcgagttcctggggcct
gtggccctcacccggcctggccctcgcccccgtggcccccgcccactgcctgccaggccc
cgagaggggccccctgagccaggcctcacactacctgacctacctgagcagttctcccca
cctgatgtggctcccccactgttggtgaagcttgtggaggccattgagcggacagggctg
gacagcgaatctctctacaggcctgagctgccacccccgtgcacagactggtccctgagc
gacctagagcagtgggactcggcagccctggctgatggcatcaagggcttccttctggcg
ctgcctgcgcccctcgtgacgctggaggccgctgcggaggcctgctgtgccctgcgggag
gcagcggggcctgtggggccaacgctggagcccccaacgctgccactgcaccacgcgctc
acgctgcgcttcctgctccagcacctgggccgggtggcccgccgcgcccctgccccccgt
tccgctttgcgagccctcggcgttgcctttgggcctctgctgctgcgtgcgccgcctccc
tcgccaccaggggtcccacctgtcgggactgagcccaaccccgacttcccagctctgctg
gtggagaagttgcttcaggaacacctggaggagcaggaggtcgcacccccagctctgccg
cctaaaccacccaaggtaaagccggcccctgcagggctggctaatggggggagccagccc
tccctgcaggatgctgagtggtactggggggacatctccagggaggaggtgaatgacaaa
ctccgggacacacctgacggcaccttcctggtccgagatgcctctagcaagattcaggga
gagtataccctgacccttaggaaaggtgggaacaacaagctaattaaggtcttccaccgt
gacgggcactatggcttctcagagccacttaccttctgctctgtcgtggacctcatcacc
cactaccgccacgagtcgctggcccagtacaatgccaaactagacacgcggctcctgtac
cctgtgtccaagtaccagcaggaccagattgttaaggaagatagtgtggaagcagtgggt
gcccagctcaaagtctaccaccagcagtaccaggacaagagccgcgagtatgaccagctc
tacgaggagtacacacgcagctcccaggaactacaaatgaagcgcactgcaatcgaggcc
ttcaatgaaaccatcaagatcttcgaagagcagggccagactcaagagaagtgcagcaag
gaatatctggagcgcttccggcgtgagggcaatgagaaagagatgcagaggatcctgctg
aactcagagcgtctcaagtctcgcatagctgagatccatgagagccgcacgaagctggag
caggagctgcggacgcaggccttggacaaccgggagattgataagcgcatgaacagcctg
aagccagacctcatgcaactacgcaagatccgagaccagtacctcgtatggctcacccag
aaaggcgcccggcagaagaaaatcaacgagtggttgggaatcaaaaatgagactgaggac
cagtatgcactgatggaggatgaggatgacctcccccaccatgaggaacgcacctggtac
gtgggcaagatcaaccggacgcaggcagaggaaatgctgaacggcaagcgggatggtacc
ttcctcatccgtgagagcagccagcggggctgctatgcctgctctgtggtggtggatggc
gataccaagcattgtgtcatctaccgcacggccactggcttgggttttgcggagccctac
aacctgtacgggtctctgaaggagctggtgctgcattaccagcacacgtccctagtgcag
cacaacgacgcgctcaccgtcacgctggcacaccccgtgcgagccccgggccctgggccc
ccgcccgcagcccgctga

KEGG   Miniopterus natalensis: 107538463
Entry
107538463         CDS       T05883                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04926  Relaxin signaling pathway
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05100  Bacterial invasion of epithelial cells
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05146  Amoebiasis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05415  Diabetic cardiomyopathy
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107538463 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107538463 (PIK3CD)
   04014 Ras signaling pathway
    107538463 (PIK3CD)
   04015 Rap1 signaling pathway
    107538463 (PIK3CD)
   04370 VEGF signaling pathway
    107538463 (PIK3CD)
   04630 JAK-STAT signaling pathway
    107538463 (PIK3CD)
   04668 TNF signaling pathway
    107538463 (PIK3CD)
   04066 HIF-1 signaling pathway
    107538463 (PIK3CD)
   04068 FoxO signaling pathway
    107538463 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    107538463 (PIK3CD)
   04072 Phospholipase D signaling pathway
    107538463 (PIK3CD)
   04071 Sphingolipid signaling pathway
    107538463 (PIK3CD)
   04024 cAMP signaling pathway
    107538463 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    107538463 (PIK3CD)
   04152 AMPK signaling pathway
    107538463 (PIK3CD)
   04150 mTOR signaling pathway
    107538463 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107538463 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    107538463 (PIK3CD)
   04218 Cellular senescence
    107538463 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107538463 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    107538463 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107538463 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107538463 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    107538463 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    107538463 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    107538463 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    107538463 (PIK3CD)
   04660 T cell receptor signaling pathway
    107538463 (PIK3CD)
   04662 B cell receptor signaling pathway
    107538463 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    107538463 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    107538463 (PIK3CD)
   04670 Leukocyte transendothelial migration
    107538463 (PIK3CD)
   04062 Chemokine signaling pathway
    107538463 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107538463 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    107538463 (PIK3CD)
   04929 GnRH secretion
    107538463 (PIK3CD)
   04915 Estrogen signaling pathway
    107538463 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    107538463 (PIK3CD)
   04917 Prolactin signaling pathway
    107538463 (PIK3CD)
   04926 Relaxin signaling pathway
    107538463 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    107538463 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    107538463 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107538463 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107538463 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    107538463 (PIK3CD)
   04722 Neurotrophin signaling pathway
    107538463 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107538463 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    107538463 (PIK3CD)
   04380 Osteoclast differentiation
    107538463 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    107538463 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    107538463 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107538463 (PIK3CD)
   05206 MicroRNAs in cancer
    107538463 (PIK3CD)
   05205 Proteoglycans in cancer
    107538463 (PIK3CD)
   05207 Chemical carcinogenesis - receptor activation
    107538463 (PIK3CD)
   05203 Viral carcinogenesis
    107538463 (PIK3CD)
   05230 Central carbon metabolism in cancer
    107538463 (PIK3CD)
   05231 Choline metabolism in cancer
    107538463 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107538463 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107538463 (PIK3CD)
   05212 Pancreatic cancer
    107538463 (PIK3CD)
   05225 Hepatocellular carcinoma
    107538463 (PIK3CD)
   05226 Gastric cancer
    107538463 (PIK3CD)
   05214 Glioma
    107538463 (PIK3CD)
   05221 Acute myeloid leukemia
    107538463 (PIK3CD)
   05220 Chronic myeloid leukemia
    107538463 (PIK3CD)
   05218 Melanoma
    107538463 (PIK3CD)
   05211 Renal cell carcinoma
    107538463 (PIK3CD)
   05215 Prostate cancer
    107538463 (PIK3CD)
   05213 Endometrial cancer
    107538463 (PIK3CD)
   05224 Breast cancer
    107538463 (PIK3CD)
   05222 Small cell lung cancer
    107538463 (PIK3CD)
   05223 Non-small cell lung cancer
    107538463 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107538463 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    107538463 (PIK3CD)
   05161 Hepatitis B
    107538463 (PIK3CD)
   05160 Hepatitis C
    107538463 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    107538463 (PIK3CD)
   05164 Influenza A
    107538463 (PIK3CD)
   05162 Measles
    107538463 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    107538463 (PIK3CD)
   05163 Human cytomegalovirus infection
    107538463 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107538463 (PIK3CD)
   05169 Epstein-Barr virus infection
    107538463 (PIK3CD)
   05165 Human papillomavirus infection
    107538463 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107538463 (PIK3CD)
   05135 Yersinia infection
    107538463 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    107538463 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107538463 (PIK3CD)
   05142 Chagas disease
    107538463 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107538463 (PIK3CD)
   05017 Spinocerebellar ataxia
    107538463 (PIK3CD)
   05020 Prion disease
    107538463 (PIK3CD)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107538463 (PIK3CD)
   05418 Fluid shear stress and atherosclerosis
    107538463 (PIK3CD)
   05415 Diabetic cardiomyopathy
    107538463 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107538463 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    107538463 (PIK3CD)
   04931 Insulin resistance
    107538463 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107538463 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107538463 (PIK3CD)
   01524 Platinum drug resistance
    107538463 (PIK3CD)
   01522 Endocrine resistance
    107538463 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107538463 (PIK3CD)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107538463 (PIK3CD)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107538463 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 107538463
NCBI-ProteinID: XP_016070211
LinkDB
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWANEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRAKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGA
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKREYLYGSYPLCQFQYICSCLHSGMTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLTLFDYKDQLKTGECCLYMWPSVPDEKGELLNPTGTVCSNPNTESAAALVICLPEVAP
YPVYYPALDKILELGRHGEHGRATEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDSSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKSPKPQTKELMHLCMR
QETYLEALSHLQSPLDPSILLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggtggactgccccatggaattctgggccaacgaggagaaccagagcgtg
gccgttgacttcctgctgcccacgggggtctatctgaacttccccgtgtcccggaacgcc
aacctcagcaccatcaagaaggtgctgtggcaccgagcccagtatgagccgctcttccac
atgctcagtgaccccgaggcctacgtgttcacctgcgtcaaccagacggcggagcagcag
gagctggaagacgagcagcggcgcctgtgtgacatccagcccttcctgccggtgctgcgc
ctggtggcccgcgagggtgacagggtgaagaaactcatcaactcgcagatcagcctcctc
attggcaaaggcctgcacgagtttgactctctgcgcgaccccgaagtgaatgactttcga
gccaagatgcgccagttctgcgaggaggcggccgcccggcggcagcagctgggctgggag
gcctggctgcaatacagcttccccctgcagctggagccctcggcgcggacctggggcgcc
ggcaccctgcgcgtccccaaccgggcgctcctggtcaatgtcaagttcgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggatgtgcccctggcgctgatggcctgcgcc
ctgcggaagaaggccacggtgttccggcagcccctggtggagcagcccgaggactacacc
ctgcaggtgaacgggaagcgcgagtacctgtatggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggatgaccccccacctgaccatggtgcactcctct
tccatcctcgccatgcgggacgagcagagcaaccctgccccccaagtccaaaagccacgc
accaaaccgccccccattcccatgaagaagccctcctccgtgtccctgtggtccctggag
cagcccttctgcgtggagctgatccagggcagcaaagtgaatgcagacgagcggatgaag
ctggtggtgcaggccgggctcttccatggcaacgagacgctgtgcaagacggtgtccagc
tccgaggtgagcgtgtgctcggagcccgtgtggaagcagcgcctggagttcgacatcaac
gtctgcgacctgcctcgcatggcccggctctgcttcgcattgtacgccgtgatcgagaag
gccaagaaggcccgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcaccctgttcgactacaaggaccagctcaagacgggcgagtgctgtctctac
atgtggccctctgtcccagatgagaaaggggagctgctgaaccccacaggaaccgtttgc
agcaaccccaacaccgagagcgcggccgccctggtcatctgcctccccgaggtggccccc
taccccgtgtattaccctgccctggacaagatcctggagctggggcggcatggggagcac
gggcgcgccactgaggaggagcagctgcagctccgggaaatcctggagcgccgtgggtcc
ggggagctgtatgagcacgagaaggacctggtgtggaagatgcgccacgaggtccaggag
cacttccccgaggccctggcccggctgctgctggtcaccaagtggaacaagcacgaggac
gtggcccagatgctctacctgctgtgctcctggccggagctgccggtcctgagtgccctg
gagctgctggactccagcttccctgaccgccacgtgggctccttcgccatcaagtcccta
cgaaaactgacagatgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tatgagtcctacctcgactgcgagctgaccaagttcctgctggaccgggccctggccaac
cgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtccgtg
gccctgcgcttcggcctcatcatggaggcctactgccggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcgctgagcaaactgaaggccttgaatgactttgtcaaa
gtgagttcccagaagagccccaagccccagaccaaggagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacctgcagtccccgctcgaccccagcatcctg
ctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagccactgtgg
gtcatgtacagcaacgaggaggcggggagcgacggcagtgtggggatcatctttaagaac
ggggatgacctccgccaggacatgctgacgctgcagatgatccagctcatggacatcctg
tggaagcaggaggggctggacctgaggatgaccccctatggctgcctctccaccggggac
cgcacgggcctcatcgaggtggtgctccactcggacaccatcgccaacatccagctaaac
aagagcaacatggcagccacggccgcgttcaacaaggacgccctgctcaactggctcaag
tctaagaaccctggggaggccctggacagagccattgaggagttcacgctctcctgcgcg
ggctactgtgtggccacgtacgtgctgggcatcggcgacaggcacagcgacaacatcatg
atccgggagaatgggcagctgttccacattgactttggccactttctggggaacttcaag
accaagttcggaatcaaccgcgagcgggtgccattcatcctcacctatgacttcgtccat
gtgattcagcagggaaagactaataacagtgagaagtttgaaaggttccggggctactgc
gagcgagcctacaccatcctgcggcgccacgggctgctcttcctccacctcttcgccctg
atgcgggcggcgggcctgcccgagctcagctgctccaaagacatccagtatctcaaggac
tctctggcgctggggaaaaccgaggaggaggcgctgaagcacttccgagtgaagtttaac
gaggcgctgcgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcaatag

KEGG   Miniopterus natalensis: 107541106
Entry
107541106         CDS       T05883                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04012  ErbB signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04218  Cellular senescence
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04380  Osteoclast differentiation
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04620  Toll-like receptor signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04650  Natural killer cell mediated cytotoxicity
mna04660  T cell receptor signaling pathway
mna04662  B cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna04668  TNF signaling pathway
mna04670  Leukocyte transendothelial migration
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04926  Relaxin signaling pathway
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna04973  Carbohydrate digestion and absorption
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05100  Bacterial invasion of epithelial cells
mna05132  Salmonella infection
mna05135  Yersinia infection
mna05142  Chagas disease
mna05146  Amoebiasis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05415  Diabetic cardiomyopathy
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107541106 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107541106 (PIK3CA)
   04014 Ras signaling pathway
    107541106 (PIK3CA)
   04015 Rap1 signaling pathway
    107541106 (PIK3CA)
   04370 VEGF signaling pathway
    107541106 (PIK3CA)
   04630 JAK-STAT signaling pathway
    107541106 (PIK3CA)
   04668 TNF signaling pathway
    107541106 (PIK3CA)
   04066 HIF-1 signaling pathway
    107541106 (PIK3CA)
   04068 FoxO signaling pathway
    107541106 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    107541106 (PIK3CA)
   04072 Phospholipase D signaling pathway
    107541106 (PIK3CA)
   04071 Sphingolipid signaling pathway
    107541106 (PIK3CA)
   04024 cAMP signaling pathway
    107541106 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    107541106 (PIK3CA)
   04152 AMPK signaling pathway
    107541106 (PIK3CA)
   04150 mTOR signaling pathway
    107541106 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107541106 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    107541106 (PIK3CA)
   04218 Cellular senescence
    107541106 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107541106 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    107541106 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107541106 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107541106 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    107541106 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    107541106 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    107541106 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    107541106 (PIK3CA)
   04660 T cell receptor signaling pathway
    107541106 (PIK3CA)
   04662 B cell receptor signaling pathway
    107541106 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    107541106 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    107541106 (PIK3CA)
   04670 Leukocyte transendothelial migration
    107541106 (PIK3CA)
   04062 Chemokine signaling pathway
    107541106 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107541106 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    107541106 (PIK3CA)
   04929 GnRH secretion
    107541106 (PIK3CA)
   04915 Estrogen signaling pathway
    107541106 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    107541106 (PIK3CA)
   04917 Prolactin signaling pathway
    107541106 (PIK3CA)
   04926 Relaxin signaling pathway
    107541106 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    107541106 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    107541106 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107541106 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107541106 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    107541106 (PIK3CA)
   04722 Neurotrophin signaling pathway
    107541106 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107541106 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    107541106 (PIK3CA)
   04380 Osteoclast differentiation
    107541106 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    107541106 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    107541106 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541106 (PIK3CA)
   05206 MicroRNAs in cancer
    107541106 (PIK3CA)
   05205 Proteoglycans in cancer
    107541106 (PIK3CA)
   05207 Chemical carcinogenesis - receptor activation
    107541106 (PIK3CA)
   05203 Viral carcinogenesis
    107541106 (PIK3CA)
   05230 Central carbon metabolism in cancer
    107541106 (PIK3CA)
   05231 Choline metabolism in cancer
    107541106 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107541106 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107541106 (PIK3CA)
   05212 Pancreatic cancer
    107541106 (PIK3CA)
   05225 Hepatocellular carcinoma
    107541106 (PIK3CA)
   05226 Gastric cancer
    107541106 (PIK3CA)
   05214 Glioma
    107541106 (PIK3CA)
   05221 Acute myeloid leukemia
    107541106 (PIK3CA)
   05220 Chronic myeloid leukemia
    107541106 (PIK3CA)
   05218 Melanoma
    107541106 (PIK3CA)
   05211 Renal cell carcinoma
    107541106 (PIK3CA)
   05215 Prostate cancer
    107541106 (PIK3CA)
   05213 Endometrial cancer
    107541106 (PIK3CA)
   05224 Breast cancer
    107541106 (PIK3CA)
   05222 Small cell lung cancer
    107541106 (PIK3CA)
   05223 Non-small cell lung cancer
    107541106 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107541106 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    107541106 (PIK3CA)
   05161 Hepatitis B
    107541106 (PIK3CA)
   05160 Hepatitis C
    107541106 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    107541106 (PIK3CA)
   05164 Influenza A
    107541106 (PIK3CA)
   05162 Measles
    107541106 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    107541106 (PIK3CA)
   05163 Human cytomegalovirus infection
    107541106 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541106 (PIK3CA)
   05169 Epstein-Barr virus infection
    107541106 (PIK3CA)
   05165 Human papillomavirus infection
    107541106 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107541106 (PIK3CA)
   05135 Yersinia infection
    107541106 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    107541106 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107541106 (PIK3CA)
   05142 Chagas disease
    107541106 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107541106 (PIK3CA)
   05017 Spinocerebellar ataxia
    107541106 (PIK3CA)
   05020 Prion disease
    107541106 (PIK3CA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107541106 (PIK3CA)
   05418 Fluid shear stress and atherosclerosis
    107541106 (PIK3CA)
   05415 Diabetic cardiomyopathy
    107541106 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107541106 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    107541106 (PIK3CA)
   04931 Insulin resistance
    107541106 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107541106 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107541106 (PIK3CA)
   01524 Platinum drug resistance
    107541106 (PIK3CA)
   01522 Endocrine resistance
    107541106 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107541106 (PIK3CA)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107541106 (PIK3CA)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107541106 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ABC1 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 107541106
NCBI-ProteinID: XP_016073555
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVVNSSLRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
NSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKEWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattagttactataaagcatgaactgtttaaagaagcaagaaagtaccctctccatcaa
cttcttcaagatgaatcttcttacatttttgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcgactctttcaaccctttttgaaa
gtaattgagccagtaggcaatcgtgaagaaaagatcctcaatcgagaaattggctttgct
atcggcatgccagtgtgtgaatttgacatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatcttaattctcctcac
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactttgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaacgcgaagtatgttgctatcatctgaacaattaaaa
ctctgtgttttagaatatcagggcaaatatattttaaaagtgtgtggatgtgatgaatac
ttcttagaaaaatatcctctgagtcaatataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttattcgcaactgccaatggac
tgttttacgatgccatcttattccagacgcatctccacagcgacaccatatatgaatgga
gagacttctacaaaatccctttgggttgtaaatagttcactcagaataaaaattctttgt
gcaacctatgtaaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggtggagagcccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cggctttgcctttccatttgttctgttaaaggtcgaaaaggtgctaaagaggaacactgt
ccattggcgtggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaatcctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagctggagtttgactggttc
aacagtgtggtcaagtttccagatatgtcagtgattgaagagcatgccaactggtctgtg
tcccgagaagcaggatttagttattcccatgcgggactgagtaacagactagctagagac
aatgaattaagggaaaatgataaagaacagctccgagccatttgtacccgagatcctctc
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaatcctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttggtaaaagagtggcctccaatcaaacctgaacaggctatggag
cttctggactgcaactacccagaccctatggttcgaggttttgctgttcgatgcttggag
aaatatttaacagatgacaaactttctcaatacctaattcaactagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtg
agccagaggttcgggctgcttttggagtcctactgccgtgcgtgtggcatgtacctgaag
cacctgaacaggcaggtggaggccatggagaagctcatcaacctgacggacatcctgaag
caggagaagaaggatgagacgcagaaggtacagatgaagtttttagttgagcaaatgcgg
cgaccagatttcatggatgctctacagggttttctgtctcctctaaatcctgctcatcag
ttaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacgacaagatatgctaacacttcaaattattcgcattatg
gaaaatatctggcaaaatcaaggccttgatcttcgaatgttaccttatggttgtctgtcc
attggggactgtgtgggactcattgaggtggtgagaaattctcacacgattatgcagatt
cagtgcaaaggtggcctgaaaggtgcactgcagttcaacagccacactctgcatcagtgg
ctcaaagacaagaacaagggagaaatatatgatgcagccattgatctgtttactcgttca
tgtgctggatattgtgtcgctactttcattttgggaattggagaccgtcacaatagcaac
atcatggttaaagatgatggacaactgttccacatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtaccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcaccaagacaagagaatttgagaggttt
caggagatgtgttacaaagcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacagtcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaacgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

DBGET integrated database retrieval system