KEGG   Miniopterus natalensis (Natal long-fingered bat): 107527309
Entry
107527309         CDS       T05883                                 
Symbol
DNAJB11
Name
(RefSeq) dnaJ homolog subfamily B member 11
  KO
K09517  DnaJ homolog subfamily B member 11
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107527309 (DNAJB11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107527309 (DNAJB11)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP40 / DNAJ
   107527309 (DNAJB11)
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 107527309
NCBI-ProteinID: XP_016055567
LinkDB
Position
Unknown
AA seq 358 aa
MAPQNLGTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDD
PRAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGN
PRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQL
GPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLR
FRIKVVKHPIFERRGDDLYTNVTISLVESLVGFDMDITHLDGHKVHISRDKITRPGAKLW
KKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggctccgcaaaacctgggcaccttctgcctgttgctactgtacctcatcggggccgtg
atcgccgggagagacttctataagatcttgggggtgcctcgaagtgcctctattaaggat
attaaaaaggcctacaggaaactagcgctgcagcttcatcctgatcggaaccctgatgat
ccacgagctcaggagaaatttcaggatttgggtgctgcttatgaggttctgtcagatagt
gagaaacggaaacaatatgatacttacggtgaagagggattaaaagatggtcatcagagc
tcccatggagacattttttcacacttctttggagattttggtttcatgtttggaggaaac
cctcgtcagcaagacagaaatattccaagaggaagtgatattattgtagatctagaagtc
actttggaagaagtatatgctggtaattttgtggaagtagttagaaacaaacctgtggca
aggcaggctcctggcaaacgaaaatgcaactgtcggcaagagatgcggaccacccaactg
ggcccagggcgcttccagatgacccaggaggtggtctgcgatgagtgccctaatgtcaaa
ctagtgaatgaagaacgaacactggaggtagaaatagagcctggggtgagagatggcatg
gagtacccctttattggagaaggtgagcctcacgtggacggagaaccaggagacttacgt
ttccgaatcaaagttgtcaagcacccaatatttgaaaggagaggagatgatttatacaca
aatgtgacaatctcattagttgagtctctagtgggctttgatatggatattactcacttg
gatggtcacaaggtacacatttcccgggataagatcaccagaccgggagccaagctatgg
aagaaaggggaagggctccccaactttgacaacaacaacatcaagggctctttgatcatc
acttttgatgtggattttccgaaagaacagttaacagaggaagcaagagaaggtatcaaa
cagctgctgaaacagggatcagtgcagaaggtatacaatggactgcaaggatattaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107535914
Entry
107535914         CDS       T05883                                 
Symbol
DNAJC10
Name
(RefSeq) dnaJ homolog subfamily C member 10
  KO
K09530  DnaJ homolog subfamily C member 10 [EC:1.8.4.-]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107535914 (DNAJC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107535914 (DNAJC10)
   04131 Membrane trafficking [BR:mna04131]
    107535914 (DNAJC10)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-
     107535914 (DNAJC10)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP40 / DNAJ
   107535914 (DNAJC10)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107535914 (DNAJC10)
SSDB
Motif
Pfam: Thioredoxin DnaJ Thioredoxin_2 OST3_OST6 Thioredoxin_8 Thioredoxin_6 Thioredoxin_7 Redoxin Thioredoxin_9 TraF
Other DBs
NCBI-GeneID: 107535914
NCBI-ProteinID: XP_016067028
LinkDB
Position
Unknown
AA seq 793 aa
MGVWLNKDDNVRDLKRVILCFLIVYMAVSVDTDQDFYSLLGVSKTASSREIRQAFKKLAL
KLHPDKNPNNPNAHSDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRY
DFGIYDDDPEIITLDRREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLR
IGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLVSFAMQHVRSTVTEL
WAGNFVNAIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCDTQANL
CLSLDITTSTTAYFPSGATLDDKEKSNVLFLNSLDAKEIYLEIMHNLPDFEQLSADTLED
RLAHHRWLLFFHFGKNGNSNDPELKKLKGLLKNEHIQVGKFDCSSAPDICSNLYVSQPCL
AVFKGQGTKEYEIHHGKKIVYDILAFAKESVHSHVTTLGPQNFPANDKEPWLVDFFAPWC
PPCRALLPELRKASKHLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNVHEYEGH
HSAEQILEFIEDLMHPSVISLSPTTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWRR
MARALTGLINVGSIDCQQFHSFCAQENVQRYPEIRFFPPKSNQADQYHSYNGWNRDAYSL
RLWGLGFLPQASIDLTPQTFNEKVLQGKNHWVVDFYAPWCGPCQNFAPEFELLARMIKGK
VKAGKMDCQANAQTCQKAGIRAYPTVRFYPYRGAKRNIWGEQIDSRDAKEISTLIYEKLE
NLQKHGMRNKDEL
NT seq 2382 nt   +upstreamnt  +downstreamnt
atgggagtctggttaaataaagatgacaatgtcagagacttgaaaagggtcattctctgt
tttctaatagtgtatatggccgtttcagtggacacagatcaggatttttacagtttactt
ggagtatccaaaactgcgagcagtagagaaataagacaagctttcaagaagctggcattg
aagcttcatcctgataaaaacccgaataacccaaacgcacatagtgattttttaaaaata
aatagagcatatgaagtactcaaagatgaagacctgcggaaaaagtatgacaaatacgga
gaaaagggacttgaagataatcaaggaggccagtatgaaagctggaattattatcgttat
gattttggtatttatgatgatgatcctgaaatcataacattggatagaagagaatttgat
gctgctgtcaattctggagaactgtggtttgtgaacttttactctccaggatgttcacac
tgccatgatttagctcccacatggagagactttgctaaagaagtggatggattacttcga
atcggagccgttaactgtggtgatgatagaatgctttgccgaatgaaaggagtaaacagt
tatcccagcctcttcatttttaggtctggaatggctgcagtgaaataccatggtgacaga
tcaaaggagagtttagtgagtttcgccatgcagcatgtcagaagcacagtgacggaattg
tgggcaggaaatttcgttaacgccatacaaactgcttttgctgctggtattggctggctg
ataactttttgctccaaaggaggagattgtttgacttcacagacacgtctcaggcttagt
ggcatgttggatggtcttgttaatgtaggatggatggactgtgacacccaggccaacctt
tgtttaagtttggatattacaacaagtactactgcctattttccttcaggagccactcta
gatgacaaagagaaaagcaatgttttgtttcttaattcactggatgctaaagaaatatat
ttggaaataatgcataatcttccagattttgaacaactatcagcagacacactagaggat
cgtttggctcatcaccggtggctcttattttttcattttggaaaaaatggaaattcaaat
gatcctgagttgaagaaactaaagggtctactaaaaaatgaacatattcaagttggcaag
tttgactgttcctctgcaccagacatctgtagcaatctctatgtctctcagccatgtcta
gcagtttttaaaggacaaggaaccaaagagtatgaaattcatcatggaaagaagattgta
tatgatatacttgcctttgccaaagaaagtgttcattctcatgtcaccacactgggacct
cagaattttcctgccaatgacaaagaaccatggcttgttgatttttttgccccttggtgt
ccaccatgtcgagctttattgccagaattacgaaaagcatcaaagcatctttatggtcag
cttaagtttggtacactagattgtacagttcatgagggactctgtaacatgtataacatt
caggcttatccaacaacagtggtgttcaaccagtccaacgtccacgaatatgaaggacat
cactctgccgaacagatcttggagttcatagaggatcttatgcatccttcagtgatctcc
ctgtcacccaccactttcaatgaactagttaaacaaagaaaacatgatgaagtctggatg
gttgatttctattctccgtggtgtcatccatgtcaagttttaatgccagaatggagaaga
atggcccgggcattaactggactgatcaatgtgggcagcatagactgccaacagtttcat
tctttttgtgctcaagaaaatgttcaaagataccctgagataagatttttccccccaaaa
tcaaatcaagctgatcaatatcatagttacaatggttggaatagggatgcctattcccta
agactctggggtctaggatttttgcctcaagcgtccatagatctaacacctcagaccttc
aatgaaaaagttttacaagggaaaaaccattgggtggttgacttctatgctccttggtgt
ggaccttgccaaaattttgctccagagtttgagctcttggctaggatgataaaaggaaaa
gtgaaagctggaaaaatggactgtcaggccaatgctcaaacatgccagaaagctggtatc
agagcctatccgactgttagattttatccctacagaggagcaaagagaaatatttgggga
gagcaaatagattccagagatgcaaaagagatttcaaccttaatatatgaaaaattggaa
aatctccaaaaacatggaatgagaaataaggatgaactttaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545897
Entry
107545897         CDS       T05883                                 
Symbol
DNAJC3
Name
(RefSeq) dnaJ homolog subfamily C member 3
  KO
K09523  DnaJ homolog subfamily C member 3
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545897 (DNAJC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    107545897 (DNAJC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107545897 (DNAJC3)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP40 / DNAJ
   107545897 (DNAJC3)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_19 DnaJ TPR_16 TPR_14 TPR_8 TPR_11 TPR_9 TPR_17 TPR_12 TPR_20 ANAPC3 TPR_21 TPR_6 PRAI TPR-S TPR_10 Ndufs5
Other DBs
NCBI-GeneID: 107545897
NCBI-ProteinID: XP_016079634
LinkDB
Position
Unknown
AA seq 504 aa
MVAPRSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQF
HAAVDGDPDNYVAYYRRATAFLAMGKSKAALPDLTKVIELKMDFTAARLQRGHLLLKQGK
LDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQALDAFDNSDYIAAITSLDKI
LEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHEL
SLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTEATSKYESVMKTEPS
VSEYTIRSKERICHCFSKDEKPVEAIRVCSEVLQVEPDNVNALKDRAEAYLIEEMYDEAI
QDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLAMQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHR
SWNSWQGFNPFSSGGPFRFKFHFN
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggtggccccccgctctgtgaccagccgactgggctcggtgttccccttcctgcttgtc
ctggtggacctgcagtacgaaggcgctgaatgtggagtaaatgcagatgttgagaaacat
cttgaattggggaagaaattacttgccgctggacagctagctgatgctttatctcaattt
catgctgcagtagatggtgacccagataactatgttgcatactatcggagagctactgcc
tttttagctatgggcaaatcaaaagcagcacttcctgatttaactaaagtgattgaattg
aagatggatttcactgcagcaagattacagagaggtcacttattactcaaacaaggaaaa
cttgatgaagcagaagatgattttaaaaaagtgctcaaatccaatccaagtgaaaatgaa
gaaaaggaagcccagtctcaacttataaaatctgatgaaatgcagcgtttgcgttcacaa
gcccttgatgcttttgacaactcggattatattgctgctataacctcccttgataagatt
ttagaggtttgtgtttgggatgctgaactacgggaacttcgagctgagtgttttataaaa
gaaggagaacctaggaaagcgataagtgacttaaaagctgcatcaaaattgaagaatgac
aacactgaggctttttataaaatcagcacactgtactatcaactaggagatcacgaactg
tccctcagtgaagttcgtgaatgtcttaaacttgaccaggatcataaaaggtgttttgca
cactataaacaagtaaagaaacttaataagctgattgagtccgctgaagagctcatcaga
gatggcagatacacagaagcgaccagcaaatacgaatctgtgatgaaaacagagcctagt
gtttctgaatacacaattcgttcaaaagaaaggatttgccactgcttttctaaggacgag
aagcctgttgaagctattcgagtgtgttctgaagttttacaggtggaacctgacaatgtg
aatgccctgaaagatcgagcagaggcctatttaatagaagaaatgtatgatgaagctatt
caggattatgaaactgctcaggaacacaatgaaaatgaccagcagattcgggaaggtcta
gagaaagcacaaagactattgaaacagtcacagaaaagagattattataaaatcttggga
gtaaaaagaaatgccaaaaagcaagaaatcattaaagcataccgaaaattagcaatgcag
tggcacccagataacttccagaatgaagaagaaaagaaaaaagctgagaaaaaattcatc
gacattgcagctgctaaagaggtcctctctgatccagaaatgaggaagaagtttgatgat
ggagaagaccccctggatgcagagagccaacaaggaggtggtggcaaccccttccacaga
agctggaactcatggcaagggttcaatcccttcagctcaggcggaccttttcgatttaaa
ttccacttcaattaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107546328
Entry
107546328         CDS       T05883                                 
Symbol
DNAJC1
Name
(RefSeq) dnaJ homolog subfamily C member 1
  KO
K09521  DnaJ homolog subfamily C member 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107546328 (DNAJC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107546328 (DNAJC1)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP40 / DNAJ
   107546328 (DNAJC1)
SSDB
Motif
Pfam: DnaJ Myb_DNA-binding Myb_DNA-bind_6 Pacs-1 DUF4234
Other DBs
NCBI-GeneID: 107546328
NCBI-ProteinID: XP_016080181
LinkDB
Position
Unknown
AA seq 522 aa
MAANSAGLGGVQERPSYEPMQAAACARPDASYQELGVQQDASSADIRKAYRKLSLTLHPD
KNKDENAETQFRQLVAIYEVLKDDERRQRYDDILINGLPDWRQPVFYYRRVRKMSNAELA
LLLFIILTVGHYAVVWSIYLEKQLDELLSRKKREKKKKTGGKSVDLSKLGASEKNERLLM
KPQWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEEALTRAELETLQKP
KKVKVKKPKPEFPVYMPLESTYIQSYDHGTSIEEIEEQMDYWLENRNRAQKKQAPEWTEE
DLSQLTRSMVKFPGGTPGRWEKIAHELGRSVTDVTTKAKQLKDSVTCSPGMVRLSELKST
AQSSRPSKTAMALPDDIITQREAEQAVGDGEDSDEQEEAEQETEVLESQPRRRRPARLPE
VATKAEPEEKFRGKRQKDFDISEQNASSDEESQKRERGRTVEEPWTQNQQKLLELALQQY
PKGSSDRWDKIAKCVPSKSKEDCIARYKLLVELVQKKKQAKS
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggctgctaattctgctggtcttggaggcgtccaggagaggccaagctatgaaccaatg
caggctgctgcttgtgccaggcctgatgcctcttatcaagagctcggggtgcagcaggat
gcttcatctgcagacattagaaaagcgtatcgtaagctttcattaactttgcatccagac
aagaataaagatgaaaatgcagaaacgcagtttagacaattggtggccatttatgaagtt
ttaaaggatgacgaacgaaggcagaggtatgatgatattctgatcaatggacttccagat
tggcgacagcctgtattctactacaggcgggtgagaaaaatgagcaatgctgagctggcg
ttacttctgttcattatcctcacagtgggtcattatgctgtagtgtggtcaatctacctg
gaaaaacaactggatgaactgcttagtagaaaaaagagagaaaagaaaaaaaagacaggc
ggcaagagtgtggatttatcaaaacttggtgcttcagaaaaaaatgaaagattactgatg
aaaccacaatggcatgatttgcttccatgcaagctggggatttggttttgccttacacta
aaagcattgcctcatctaatccaggatgctgggcagttttatgctaaatataaggaaaca
agattgaaggaaaaggaagaggcattgactagagctgaacttgaaacacttcaaaagccg
aagaaagttaaagtaaaaaaaccaaaacctgaatttcctgtgtatatgcctttggaaagt
acatatattcaatcatatgatcatggaacttctatagaagaaatcgaggaacaaatggat
tattggctggaaaacaggaacagagcacagaaaaaacaggcacctgaatggacagaagag
gacctcagccagctgacaagaagtatggttaagttcccaggagggaccccaggtcgatgg
gaaaagattgctcacgaattgggtcgatcggtgacagatgtgacaaccaaagccaaacaa
ctgaaggattcagttacctgctccccaggaatggttagactctcggaactcaaatcaaca
gctcagagctccaggcccagcaaaaccgccatggccctgcccgacgacatcatcacgcag
cgggaagccgagcaggccgtgggggacggcgaggacagtgacgagcaggaggaagcggaa
caggagaccgaggtcctggaaagccagccgaggagacgcaggccagccaggctgcccgag
gtagcgacaaaggcagagccagaggagaagttccgtggaaagaggcagaaggactttgat
atatcagaacaaaatgcatcgagcgatgaggagagccagaagagagagagaggtcgcact
gtagaggagccatggactcagaatcaacagaaactcctggaattagcattacagcaatac
ccaaaaggatcctctgaccgctgggacaaaatagccaaatgtgtcccgtcgaagagtaag
gaagactgtatcgctagatacaagctgctggttgaactggtccaaaagaaaaaacaagct
aaaagttga

DBGET integrated database retrieval system