KEGG   Miniopterus natalensis: 107528003
Entry
107528003         CDS       T05883                                 

Gene name
ATP2A3
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 3
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04919  Thyroid hormone signaling pathway
mna04972  Pancreatic secretion
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107528003 (ATP2A3)
   04024 cAMP signaling pathway
    107528003 (ATP2A3)
   04022 cGMP-PKG signaling pathway
    107528003 (ATP2A3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107528003 (ATP2A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107528003 (ATP2A3)
   04261 Adrenergic signaling in cardiomyocytes
    107528003 (ATP2A3)
  09154 Digestive system
   04972 Pancreatic secretion
    107528003 (ATP2A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528003 (ATP2A3)
   05017 Spinocerebellar ataxia
    107528003 (ATP2A3)
   05022 Pathways of neurodegeneration - multiple diseases
    107528003 (ATP2A3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107528003 (ATP2A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107528003 (ATP2A3)
   05414 Dilated cardiomyopathy
    107528003 (ATP2A3)
   05415 Diabetic cardiomyopathy
    107528003 (ATP2A3)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107528003 (ATP2A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Hydrolase_3 HAD DUF3106
Other DBs
NCBI-GeneID: 107528003
NCBI-ProteinID: XP_016056396
LinkDB
Position
Unknown
AA seq 919 aa
MTAFVEPLVIMLILVANAVVGVWQERNAESAIEALKEYEPEMGKVIRSGRSGVQRIRARD
IVPGDIVEVAVGDKVPADLRLVEIKSTTLRVDQSILTGESVSVTKHTDAIPDPRAVNQDK
KNLLFSGTNIASGKAVGVAVATGLNTELGKIRSQMAAVEPERTPLQQKLDEFGRQLSRAI
SVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTR
RMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVAEAEAGACRLHEFTI
SGTTYAPEGEVLQGEQPVRCGQFDGLVELATICALCNDSALDYNEAKGVYEKVGEATETA
LTCLVEKMNVFDTNLQVLSQVERAGACNAVISQLMRKEFTLEFSRDRKSMSVYCTPTRPG
LAAQGSKMFVKGAPESVIERCTSVRVGSRTVPLNTTSREQILAKIRDWGSGSDTLRCLAL
ATRDAPPRREDMQLDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACIKRCYQAGIRVVMI
TGDNKGTAVAICRRLGIFKDTEDVVGKAYTGREFDDLSPEQQRHACRTARCFARVEPAHK
SRIVEYLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIV
AAVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPA
TALGFNPPDLDIMEKLPRNPREALISGWLFFRYLAIGVYVGLATVAAATWWFLYDAEGPH
ITFYQLRNFLKCSEDNPLFAGVDCEVFESRYPTTMALSVLVTIEMCNALNSVSENQSLLR
MPPWLNPWLLAAVLMSMALHFLILLLPPLPLIFQVTPLSGRQWVVVLQISLPVILLDEAL
KYLSRNHVDVFLPEEKDQK
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgacagccttcgtggagcccctggtcattatgctgatccttgtggccaatgcagtcgtg
ggcgtgtggcaggaacgcaacgccgagagtgccattgaggctctgaaggagtatgaacct
gagatgggcaaggtgatccgctctggccgaagtggtgtgcagaggatccgtgcacgggac
atcgtccctggggacatcgtggaagtggcagtgggagacaaagtgcctgctgatctccgc
ctcgttgagatcaagtccaccacgctgagagtggaccagtccatcctgacaggtgaatcc
gtgtccgtgaccaagcacacagatgccatcccagatcccagagctgtgaaccaggacaag
aagaacctgctgttttctggcaccaacatcgcatctgggaaggcagtgggtgtggcagtg
gccacaggcctgaacacggagctgggtaagatccggagccagatggcggctgtggagcca
gagcggacgccgttgcagcagaaactggatgagtttgggcgacagctgtcccgtgccatc
tccgtgatctgcgtggccgtgtgggtcatcaacattggccactttgccgacccagcacac
ggcggctcctggctccgaggagccgtgtactacttcaagattgcggtggccctggctgtg
gccgccatccccgagggcctcccagctgtcatcactacatgcttggcgctgggcacacgg
cgcatggcccgcaagaacgccattgtacgaagtctgccctctgtggagaccctgggctgc
acctcggtcatctgctccgacaagacaggcactctcaccaccaatcagatgtctgtctgc
cggatgttcgtggtagccgaggcagaagccggtgcgtgccgtttgcacgagttcaccatc
tcgggtaccacctacgccccagagggcgaagtgctgcagggagagcagcctgtgcgctgc
gggcagttcgatgggctggtggagctggcgaccatctgtgccctgtgcaacgactccgca
ctggactacaacgaggccaagggcgtgtatgagaaggtgggagaagccacagagacggcc
ctgacttgcctggtggagaagatgaacgtgttcgacaccaacctgcaggtcctatcccaa
gtggaacgtgccggcgcctgcaacgcggtcatcagtcagctgatgcggaaggagttcacc
ctggagttctcccgggaccgcaagtcgatgtcggtgtactgcacgcctacccgccccggc
ctggcggcccagggcagcaagatgtttgtgaagggggctcctgagagtgtgatcgaacgg
tgcacctcagtccgagtagggagccgcacagtgcctctgaacaccacctccagggagcag
atcctagccaagattcgggactggggctcaggctcggacacgctgcgctgcctggcactg
gccacccgggacgcgcccccgaggagggaagacatgcagctggatgactgcagcaagttt
gtacagtatgagacggacctgactttcgtgggctgcgtgggtatgctggaccctccgagg
cctgaggtggctgcctgcatcaaacgctgctaccaggcaggcatccgtgtggtcatgatc
accggggacaacaaaggcacggctgtggcgatctgccgtcggcttggcatcttcaaggac
acagaggacgtggtgggcaaggcctacacaggccgcgaattcgatgacctcagccccgag
cagcagcgccacgcctgtcgcacagcccgctgctttgcccgagtggaacctgcacacaag
tcccgcatcgtggagtatttacagtcctttaacgagatcactgccatgactggagatggg
gtgaacgacgccccagccctgaagaaagcagaaatcggcattgccatgggctccggcaca
gctgtggccaagtcggcagcagagatggtactgtcagatgacaactttgcctccattgtg
gctgcagtggaggaaggccgggccatctacagcaacatgaagcaattcatccgctacctc
atctcctccaatgtcggcgaggtcgtctgcatcttcctcacggcaattctgggcctgcct
gaagccctcatccctgtgcagctgctctgggtgaacctggtgacggatggcctacctgcc
acagccctgggcttcaaccctccagacctggacatcatggagaagctgccccggaaccct
cgagaggccctcatcagtggttggctcttctttcgatatctggctattggagtgtacgtt
ggactggccacagtggctgccgccacctggtggttcctgtatgatgctgaaggacctcac
atcaccttctaccaactgaggaacttcctgaagtgctctgaggacaacccgctctttgcc
ggcgttgactgcgaggttttcgagtcccgctaccccacgaccatggccttgtctgtgctg
gtgaccattgaaatgtgcaacgccctcaacagcgtctcagagaaccagtcgctgctgcgg
atgccgccctggctgaacccctggctgctggcagctgtgctcatgtccatggccctgcac
ttcctcatcctgctcctgccgcccctgcccctcattttccaggtgaccccactgagtggg
cgccagtgggtggtggtgctccagatatctctgcctgtcatcctgctggatgaggccctc
aagtacctgtcccggaaccacgtggatgtttttcttccagaagaaaaagaccagaagtga

KEGG   Miniopterus natalensis: 107529595
Entry
107529595         CDS       T05883                                 

Gene name
ATP2A2
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04919  Thyroid hormone signaling pathway
mna04972  Pancreatic secretion
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107529595 (ATP2A2)
   04024 cAMP signaling pathway
    107529595 (ATP2A2)
   04022 cGMP-PKG signaling pathway
    107529595 (ATP2A2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107529595 (ATP2A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107529595 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    107529595 (ATP2A2)
  09154 Digestive system
   04972 Pancreatic secretion
    107529595 (ATP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107529595 (ATP2A2)
   05017 Spinocerebellar ataxia
    107529595 (ATP2A2)
   05022 Pathways of neurodegeneration - multiple diseases
    107529595 (ATP2A2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107529595 (ATP2A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107529595 (ATP2A2)
   05414 Dilated cardiomyopathy
    107529595 (ATP2A2)
   05415 Diabetic cardiomyopathy
    107529595 (ATP2A2)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107529595 (ATP2A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 107529595
NCBI-ProteinID: XP_016058547
LinkDB
Position
Unknown
AA seq 917 aa
MGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESV
SVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQE
RTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVA
AIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSACR
MFILDKVEGDTCFLNEFTISGSTYEPTGEVYKDDKPVKCHQYDGLVELATICALCNDSAL
DYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTL
EFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTNIRVGSTKVPMTPGIKQKIM
SVIREWGSGSDTLRCLALATHDNPLRREDMNLEDSANFIKYETNLTFVGCVGMLDPPRIE
VASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQNEDVTAKAFTGREFDELSPAAQ
RDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAV
AKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEA
LIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGA
ATVGAAAWWFIAADGGPRVSLYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVT
IEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQ
WLMVLKISLPVILLDETLKFVARNYLEPGKECVQPASKSCSFSACTDGISWPFVLFIMPL
VIWVYSTDTNFSDMFWS
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgggcaaagtgtatcgacaggacagaaagagtgtacagcggattaaagctaaagacata
gttcctggtgatattgtagaaattgctgttggtgacaaagttcctgctgatataaggtta
acttccatcaagtctactactctaagagttgaccagtcaattctcacaggtgaatctgtt
tctgtcatcaagcacactgaccccgtccctgacccacgggctgttaaccaagataagaag
aacatgctcttttctggtacgaacattgctgctggcaaagccatgggagtggtggtagca
actggagttaacactgaaattggcaagatccgggatgaaatggtagcaacggaacaggag
agaacacctctccagcaaaaactagatgaatttggggagcagctttccaaagtcatctcc
cttatttgcatcgcagtctggatcataaacattgggcacttcaatgatccagttcatgga
ggctcctggatcagaggtgctatttactactttaaaatcgcagtggccctggctgtagca
gccattcctgaaggtctgcctgctgtgatcaccacctgcctggcccttggaactcgcaga
atggcaaagaaaaatgccatcgttcgaagcctcccttctgtggaaacccttggttgtact
tctgttatctgctcagacaagactggtacacttacaacgaaccagatgtcagcctgcagg
atgttcattctggacaaagttgaaggtgatacttgtttcctgaatgaattcaccataagt
gggtcaacatatgaaccaactggagaagtgtataaagatgataaaccagtgaaatgtcat
caatatgatggccttgtagaattggcaacaatttgtgctctttgtaatgactctgctttg
gattacaatgaggcaaagggtgtgtatgaaaaagttggagaagctacagagactgctctc
acttgcctggtagagaagatgaatgtatttgatacggaattgaagggtctttccaagata
gaacgagcgaatgcctgcaactcggtcattaaacaattgatgaaaaaagaatttactcta
gagttttcacgtgatagaaaatcaatgtcggtttattgtaccccaaacaagccaagccgg
acgtcgatgagcaaaatgtttgtgaagggtgctcctgaaggtgtcattgacaggtgcacc
aacattcgagttggaagcactaaagttcctatgacccctggaatcaagcagaagatcatg
tctgtcattcgggaatggggtagtggcagtgacacactgcgatgcctggctctggccact
cacgacaatccactgagaagagaagatatgaaccttgaggactctgccaactttattaaa
tatgagaccaatttgactttcgttggctgcgtgggcatgctggaccctccgaggattgaa
gtcgcctcttctgtgaagctgtgccggcaggcaggcatccgggtcatcatgatcacgggg
gacaacaagggcactgccgtggccatctgtcgccgcattggcatctttgggcagaatgag
gatgtgacagcaaaggctttcacaggccgggagttcgacgagctcagtcctgcagcccag
agagatgcctgcttgaatgcccgctgcttcgctcgagtcgaaccttcccacaagtctaaa
attgtagaatttcttcagtcttttgatgagattacagctatgactggggatggtgtgaat
gatgctcctgctctgaagaaagccgagatcggcatcgccatgggctctggcaccgcggtg
gctaaaaccgcctcggagatggtcctggccgacgacaacttctccaccatcgtggctgct
gtggaggagggacgggcaatatacaacaacatgaagcagttcatccgctacctcatctca
tcgaacgtgggggaagttgtctgcattttcctgacagctgcccttggatttcctgaggct
ttaattcctgtccagctgctctgggtcaatttggtgacagatggcctgcctgccaccgca
ctggggttcaacccccctgatctggacatcatgaataaacccccccggaacccgaaggag
ccgctgatcagtgggtggctgtttttccgttacctggctattggctgttatgttggcgct
gctactgtgggtgctgctgcgtggtggttcattgctgctgatggtggtccaagagtgtcc
ttataccagctgagtcatttcctacagtgtaaagaggacaacccagactttgaaggagtg
gattgtgcaatctttgaatccccatacccgatgacaatggcactctctgttctagtaacc
atagagatgtgtaacgccctcaacagcttgtctgaaaaccagtccctgctgaggatgccc
ccttgggagaatatctggctcgtgggctccatctgcctgtccatgtcgctccacttccta
atcctctatgtggaacccttgccacttatcttccagatcacaccgctaaatttgacccag
tggctgatggtgctgaaaatctccttgcctgtgattctattggatgagacgcttaagttt
gtggcccgcaactacctggaacctggtaaagagtgtgtgcagcctgccagcaaatcctgc
tcgttctcggcatgcaccgatgggatttcctggccgtttgtgctgttcataatgcccctt
gtgatctgggtgtatagcacagacactaactttagcgatatgttctggtcttga

KEGG   Miniopterus natalensis: 107541012
Entry
107541012         CDS       T05883                                 

Gene name
ATP2A1
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04919  Thyroid hormone signaling pathway
mna04972  Pancreatic secretion
mna05010  Alzheimer disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107541012 (ATP2A1)
   04024 cAMP signaling pathway
    107541012 (ATP2A1)
   04022 cGMP-PKG signaling pathway
    107541012 (ATP2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107541012 (ATP2A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107541012 (ATP2A1)
   04261 Adrenergic signaling in cardiomyocytes
    107541012 (ATP2A1)
  09154 Digestive system
   04972 Pancreatic secretion
    107541012 (ATP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107541012 (ATP2A1)
   05017 Spinocerebellar ataxia
    107541012 (ATP2A1)
   05022 Pathways of neurodegeneration - multiple diseases
    107541012 (ATP2A1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107541012 (ATP2A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107541012 (ATP2A1)
   05414 Dilated cardiomyopathy
    107541012 (ATP2A1)
   05415 Diabetic cardiomyopathy
    107541012 (ATP2A1)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107541012 (ATP2A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 107541012
NCBI-ProteinID: XP_016073400
LinkDB
Position
Unknown
AA seq 1000 aa
MESAHSKSTEECLAYFGVSETTGLTPDQVKRHLEKYGPNELPAEEGKSLWELVVEQFEDL
LVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSIL
TGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKAVGIVATTGVSTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFVIDRVDGDSCVLNEFSITGSTYAPEGEVLKNDKPVRAGQYDGLVELATICALC
NDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPMTGPV
KEKIMTVIKEWGTGRDTLRCLALATRDTPPKREDMVLDDSAKFMEYEMDLTFVGVVGMLD
PPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVTDRAYTGREFDDL
PLGEQREACRRACCFARVEPAHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIG
GYVGAATVGAAAWWFLYAEDGPHVSYNQLTHFMQCTEDNPDFEGVECEIFEAPEPMTMAL
SVLVTIEMCNALNSLSENQSLMRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRA
LDLTQWLMVLKISLPVIGLDELLKFVARNYLEDPEDERRK
NT seq 3003 nt   +upstreamnt  +downstreamnt
atggagtctgcacactccaagagcacagaggaatgtctggcctattttggggtgagcgag
actacaggcctcaccccggaccaagttaagcggcatctggagaaatacggccccaatgag
ctacctgctgaggaagggaagtccctgtgggagttggtagtagagcagtttgaagacctc
ctggtgcggatccttctcctggccgcctgcatttccttcgtgctggcctggtttgaggaa
ggtgaagagaccgtcactgcctttgtcgagccctttgtcatcctcttgatcctcattgcc
aatgccatcgtgggggtttggcaggaacgtaatgcagagaacgccattgaggctctgaag
gaatatgaacccgagatggggaaagtctaccgggctgaccgaaagtcagtgcagaggatc
aaggctcgggacattgtcccaggggacattgtggaggtggctgtgggggacaaagtccct
gcagatatccgcatcctctccatcaaatctaccaccctccgggttgaccagtccatcctg
acaggcgagtccgtatctgtcatcaagcacacagagcccgttcctgacccccgagctgtc
aaccaggataagaagaacatgcttttctcgggcaccaacattgcagctggcaaggccgta
ggcatcgtagccactactggtgtgagcaccgagattgggaagatccgcgaccaaatggcc
gccacagaacaggacaagacccctctgcagcagaagctggatgagtttggggagcagctc
tccaaggtcatctctctcatctgcgtggctgtgtggcttatcaacatcggccacttcaac
gatcccgtccatgggggctcctggttccgtggtgccatctactactttaagattgctgtg
gccctggctgtggctgcaatcccagaaggtcttcctgcagtcatcaccacctgcttggcc
ttgggcacccgccggatggcaaagaaaaatgcaattgtgaggagcttgccctctgtcgag
actctgggctgcacctcggtcatctgttccgacaaaacaggcaccctcaccaccaaccag
atgtctgtctgcaagatgtttgtcatcgacagggtggacggggactcctgcgtgctgaac
gagttctctatcactggttccacttacgctccagaaggagaggtcttgaagaatgataag
ccagtccgggcagggcagtatgatgggctggtggagctggccaccatctgtgccctctgc
aatgactcctccttggacttcaacgaggccaagggtgtttacgagaaggtaggcgaggcc
accgagacagcgctcaccaccctggtagagaagatgaacgtattcaacactgacgtgcgc
agcctctcaaaggtggagagggccaatgcctgcaactcggtgatccgccagctaatgaag
aaggaattcaccctggagttctcccgagacagaaagtccatgtctgtctattgctcccca
gccaaatcccgggctgctgtaggcaacaagatgtttgtcaagggtgctcccgagggggtc
attgaccgttgtaactatgtgcgagttggtaccacccgcgtgccaatgacagggccggtg
aaggagaagatcatgaccgtgatcaaggagtggggcactggccgggacaccttgcgctgc
ctggctctggccacccgggacacccccccgaagcgagaagatatggtcttggatgactct
gccaaattcatggagtatgagatggacctgacattcgtcggcgtggtaggcatgttggac
cctccccgaaaggaggtcacaggctctatccagctgtgccgtgatgctgggatccgagtg
atcatgattactggggacaacaagggcacagccattgccatctgccggagaattggcatc
tttggggagaacgaggaggtgaccgaccgagcctacactggccgggagtttgatgacctg
cccctgggtgagcagcgggaggcctgccgtcgtgcctgctgctttgcccgcgtggagcct
gcccataagtcgaagattgtggagtatttgcagtcttacgatgagatcacagctatgaca
ggggatggtgtcaatgatgcccctgctctgaagaaggctgagatcggcattgccatgggc
tctggcactgctgtggccaagaccgcctccgagatggtgctggctgacgacaacttctcc
accatcgtggctgctgtggaggagggccgggccatctacaacaacatgaagcagttcatc
cgctacctcatctcctccaacgtgggcgaggtggtctgcatcttcctgacagccgccttg
gggctgcctgaggccctgatccctgtgcagctgctgtgggtgaacttggtgactgatggg
ctcccagccacagccctgggcttcaatcccccagacctggacatcatggaccggcccccc
cggagccccaaggagcccctcatcagtggctggcttttcttccgctacatggcaattggg
ggctacgtgggtgcagccactgtgggagcggctgcctggtggttcctgtatgcggaggat
gggcctcacgtcagctacaaccagctgactcacttcatgcagtgcaccgaggacaacccc
gactttgagggtgtggagtgtgagatctttgaggctcctgagcccatgaccatggccttg
tctgtgctggtcaccattgagatgtgcaatgctctcaacagcctctctgagaaccagtcc
ctcatgcgcatgccaccctgggtgaacatctggctgctgggctccatttgcctgtccatg
tccctccatttcctcattctctacgtcgaccctctgccgatgatcttcaagcttcgggcc
ctggacttgactcagtggctcatggttctcaagatctcattgccagtcatcgggctcgac
gaactcctcaagttcgttgctcggaactacctggaggatccagaagatgaaagaaggaag
taa

DBGET integrated database retrieval system