KEGG   Miniopterus natalensis (Natal long-fingered bat): 107528039
Entry
107528039         CDS       T05883                                 
Symbol
UBE2G1
Name
(RefSeq) ubiquitin-conjugating enzyme E2 G1
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
mna05012  Parkinson disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107528039 (UBE2G1)
   04120 Ubiquitin mediated proteolysis
    107528039 (UBE2G1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107528039 (UBE2G1)
   05022 Pathways of neurodegeneration - multiple diseases
    107528039 (UBE2G1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107528039 (UBE2G1)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107528039 (UBE2G1)
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107528039 (UBE2G1)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 107528039
NCBI-ProteinID: XP_016056440
LinkDB
Position
Unknown
AA seq 170 aa
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT
FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI
MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacggagctgcagtcggcactactactgcgaagacagctggcagaactcaacaaaaac
ccagtggaaggcttttcagcaggtttaatagatgacaatgatctctaccgatgggaagtc
cttattattggtcctccagatacactttatgaaggtggtgtttttaaggctcatctcact
ttcccaaaagattatcccctccggcctcctaaaatgaaattcattacggaaatctggcac
ccaaatgttgataaaaatggtgatgtatgcatttctattcttcatgagcctggagaagat
aaatatggttatgaaaaaccagaggaacgctggctccccattcacaccgtggaaaccatc
atgattagtgttatttctatgctggcagaccctaatggagactcacctgctaatgttgat
gctgcgaaagaatggagggaagacagaaatggagaattcaaaaggaaagttgcccgctgt
gtaagaaaaagccaagagactgcttttgagtga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107537476
Entry
107537476         CDS       T05883                                 
Symbol
UBE2G2
Name
(RefSeq) ubiquitin-conjugating enzyme E2 G2
  KO
K04555  ubiquitin-conjugating enzyme E2 G2 [EC:2.3.2.23]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
mna05012  Parkinson disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107537476 (UBE2G2)
   04120 Ubiquitin mediated proteolysis
    107537476 (UBE2G2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107537476 (UBE2G2)
   05022 Pathways of neurodegeneration - multiple diseases
    107537476 (UBE2G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107537476 (UBE2G2)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     107537476 (UBE2G2)
Ubiquitin system [BR:mna04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   107537476 (UBE2G2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 107537476
NCBI-ProteinID: XP_016068998
LinkDB
Position
Unknown
AA seq 159 aa
MVLLFNFAELTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPL
SPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSM
LAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
NT seq 480 nt   +upstreamnt  +downstreamnt
atggttttactttttaattttgcagagttaacactgaatcctccagagggaattgtggca
ggccccatgaatgaagagaatttttttgaatgggaggcattgatcatgggcccagaagac
acttgctttgagtttggtgtttttcctgccatcctgagtttcccgcttgattacccattg
agtcctccaaagatgagatttacctgtgagatgtttcatcccaacatctaccctgatggc
agagtctgcatttccatcctccatgctccgggtgacgaccccatgggctacgagagcagc
gctgagaggtggagccctgtgcagagcgtggagaagatcttgctgtcggtggtgagcatg
ctggcagagcccaatgatgaaagcggcgctaatgtggatgcttccaaaatgtggcgggat
gaccgagagcagttttacaagattgccaagcagatcgttcagaagtctctggggctctaa

DBGET integrated database retrieval system