KEGG   Miniopterus natalensis (Natal long-fingered bat): 107528049
Entry
107528049         CDS       T05883                                 
Symbol
DERL2
Name
(RefSeq) derlin-2 isoform X1
  KO
K13989  Derlin-2/3
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107528049 (DERL2)
SSDB
Motif
Pfam: DER1 Oleosin
Other DBs
NCBI-GeneID: 107528049
NCBI-ProteinID: XP_016056453
LinkDB
Position
Unknown
AA seq 282 aa
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN
FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTIFGLFVSLVFL
GQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH
IYFFLEDIFPNQPGGIRILKTPAILKAIFDTPDEDPNYNPLPEERPGGFAWAFNWISFQD
WKYAADNLWLYIYILLIQNASSSRKICFCCPGSLFSSGFYKT
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcgtaccagagcctccggctggagtacctgcagatcccaccggtcagccgcgcctac
accaccgcctgcgtcctcactaccgctgctgtgcagttggaattgatcacaccttttcag
ctgtacttcaatcctgaattaatctttaaacacttccaaatatggaggctaatcaccaat
ttcttattttttggaccagttggattcaactttttatttaacatgatatttctataccgt
tactgtcgaatgctagaagaaggctctttccgaggtcggacagcagactttgtatttatg
ttcctttttggtggattcttaatgactatttttggtttgtttgtgagcttagttttcttg
ggccaggcctttacaataatgcttgtctacgtgtggagccgaaggaacccctatgtccgc
atgaacttcttcggccttctcaatttccaggccccctttctaccgtgggtgctcatgggc
ttttccttgttgctggggaactcaatcattgtggacctcttaggtattgcagtcggacac
atttattttttcttggaagatatatttcccaatcaacctggtggaataagaattctgaaa
acaccagctattttgaaagctatttttgatacaccagatgaggatccaaattacaatcca
ctacctgaagagcggccaggaggcttcgcctgggctttcaactggatttcatttcaagat
tggaaatatgcggctgataatctgtggctgtatatatacatcttactaattcagaatgcc
agctccagtaggaagatttgtttctgttgtccaggcagtttgttctcatcggggttttac
aaaacttga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107530530
Entry
107530530         CDS       T05883                                 
Symbol
DERL3
Name
(RefSeq) derlin-3
  KO
K13989  Derlin-2/3
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107530530 (DERL3)
SSDB
Motif
Pfam: DER1 Oleosin
Other DBs
NCBI-GeneID: 107530530
NCBI-ProteinID: XP_016059795
LinkDB
Position
Unknown
AA seq 231 aa
MAWRGLAAEFQQVPAVTRAYTAACVLTTAAVQLDLLSPFQLYFNPHLVFRKFQVWRLLTN
FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMILLGLLGSLFFL
GQALIAMLVYVWSRRSPQVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH
IYYFLEDVFPNQPGGKRLLLTPGFLKLLLDTPEEDPNYLPLPEEQPGPLQQ
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcgtggcgggggctggcggccgagtttcagcaggtgccggcagtgacgcgggcttac
accgcggcctgcgtcctcaccacagccgctgtgcagctggatctccttagccccttccag
ctctacttcaacccgcacctcgtgttccggaagttccaggtctggaggctcctcaccaac
ttcctcttcttcggtcccctgggattcagcttcttcttcaacatgctcttcgtattccgc
tactgccgcatgctggaggagggctctttccgcggccgcacggcagacttcgtcttcatg
tttctctttgggggcgtccttatgattctgctggggctcctgggcagcctgttcttcctg
ggccaggccctcatagccatgctggtgtatgtatggagccgccgtagccctcaggtgagg
gtcaacttcttcggcctcctcaccttccaggcgccattcctgccctgggcactcatgggc
ttctcactgctgctgggcaactcaatcctcgtggacctgctggggattgctgtgggacac
atctactacttcctagaggatgtctttcccaaccagcctggaggcaagagactgctgctg
accccgggcttcctgaagctgctactggacacccctgaagaggaccccaattacctgccc
ctccctgaggagcagccaggacccctgcagcagtga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107533169
Entry
107533169         CDS       T05883                                 
Symbol
DERL1
Name
(RefSeq) derlin-1
  KO
K11519  Derlin-1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107533169 (DERL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107533169 (DERL1)
   05022 Pathways of neurodegeneration - multiple diseases
    107533169 (DERL1)
SSDB
Motif
Pfam: DER1 ActD
Other DBs
NCBI-GeneID: 107533169
NCBI-ProteinID: XP_016063234
LinkDB
Position
Unknown
AA seq 251 aa
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYFVLWPEAFLYRFQIWRPITATF
FFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG
HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH
NWGQGFRLGDQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtcggacatcggggactggttcaggagcatcccggctatcactcgctattggttcgcc
gccaccgtcgcggtgcccttggtcggcaaactcggtctcatcagcccggcctacttcgtc
ctctggcccgaagcatttctctaccgcttccagatttggagaccaatcactgccaccttt
tttttccctgtgggtccaggaaccggatttctttatttggtcaatttatatttcttatat
cagtattctacacgacttgaaacaggagcttttgatgggaggccagcagactatttattc
atgctcctctttaactggatttgcatcgtcattactggcttagcaatggacatgcagttg
ctgatgattcctctgataatgtcggtgctttatgtctgggcccagctgaacagagacatg
attgtgtcgttttggttcggaacacgatttaaggcctgttatttaccttgggttatcctt
ggattcaactatatcatcggaggctcggtaatcaatgagctaattggaaatctggttgga
catctttacttcttcctaatgttcagataccctatggatttaggaggaagaaattttctt
tccacaccccagtttttgtaccgctggctgcccagcaggagaggaggagtgtcaggattt
ggtgtgccccctgctagcatgaggcgagctgctgatcagaatggtggaggcggcagacac
aactggggacagggctttcgacttggggaccagtga

DBGET integrated database retrieval system