KEGG   Miniopterus natalensis: 107528447
Entry
107528447         CDS       T05883                                 

Gene name
NEO1
Definition
(RefSeq) neogenin isoform X1
  KO
K06766  neogenin
Organism
mna  Miniopterus natalensis
Pathway
mna04350  TGF-beta signaling pathway
mna04360  Axon guidance
mna04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107528447 (NEO1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107528447 (NEO1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    107528447 (NEO1)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind Ig_5 C2-set_2 fn3_2 DUF4959 Tissue_fac SusE Ig_6 EphA2_TM TMEM154 Ly49 FAM176
Other DBs
NCBI-GeneID: 107528447
NCBI-ProteinID: XP_016057023
LinkDB
Position
Unknown
AA seq 1454 aa
MAAERGARRLLSTSSFWLCCLLLLGHRAPDAEAARSGSPPQSPGSSIRTFTPFYFLVEPM
DTLSIRGSSVVLNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLSDGSLFISNVVHSKHN
KPDEGYYQCVATVESLGTIVSRTAKLTVAGLPRFASQPEPSSVYAGNSAILNCEVNADLV
PFVRWEQNRHPLLLDGRVIKLPSGTLVISNATERDGGLYRCLIESGGPPKYSDEAELKVL
PDPEVTSNLVFLKQPSSLVRVIGQSAVLPCVASGLPLPTIRWTKNEEALDTESSERLVLL
PGGSLEISDVTEDDAGTYFCVADNGNETVEAQAELTVQAQPEFLKQPTNIYAHESMDIVF
ECEVTGKPVPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQ
AGAQLIILEHDVAIPTLPPTSLTSATTDHLAPATTGPLPSAPRDVVASLVSTRFIKLTWR
TPASDPHGDNLTYSVFYAKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAHNKHG
SGESSAPLRVETQPEVQLPGPAPNIRAYATSPTSITVTWETPLSGNGEIQNYKLYYMEKG
TDKEQDVDVSSHSHTINGLKKYTEYSFRVVAYNKHGPGVSTQDVAVQTSSDVPSAAPQNL
SLEVRNSKSIMIHWQPPPPATQNGQITGYKIRYRKASRKSDVTETLVPGTQLSQLIEGLD
RGTEYNFRVAALTVNGTGPATDWLSTETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTP
PENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIP
LYESAVTRPHTVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWK
TNIPANTKYKNANATTLSYLVTGLKANTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTS
PPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLT
HQIQELTLDTPYYFKIQARNSKGMGPMSDAVQFRTPKASGSAGKGSRLPDLGSDYKPPMS
GSNSPHGSPTSPLDSNMLLVIIISVGVITIVVVVVIAVFCTRRTTSHQKKKRAACKSVNG
SHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSN
IHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHHFHS
SSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDHQDP
EGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPTYDPALPSTPLLSQ
QALNHHIHSVKTASIGTLGRSRPPMPVVVPNAPEVQETTRMLEDSESSYEPDELTKEMAH
LEGLMKDLNAITTA
NT seq 4365 nt   +upstreamnt  +downstreamnt
atggcggcggagcggggagctcggcgactcctcagcacctcctccttttggctctgttgc
ctgctgctgcttgggcaccgggcgccggacgccgaggccgccagaagcggctccccgccg
cagtccccaggatccagcattcgaacattcactccattttattttctggtggagccaatg
gatacactatcaattagaggctcttctgttgtattgaactgttcagcatattctgagcct
tctccaaaaattgaatggaaaaaagatggaacatttttaaatttagtatcagatgatcga
cgccagcttctctcagatgggtctttatttatcagcaatgtggtacattccaaacacaat
aaacctgatgaaggttattatcaatgtgtggccactgttgagagtcttggaactattgtc
agcagaacagcgaagctcacagtagcaggtcttccaagatttgccagccaaccagaacct
tcttcagtttatgctgggaacagtgcaattctgaattgtgaagttaatgcagatttggtc
ccatttgtgagatgggaacagaacaggcaccctcttcttctggatggtagagtcatcaaa
cttccaagtggaacactggttatcagcaatgcgactgaaagagatgggggactttatcgc
tgcttaattgaaagtggtgggccaccaaagtatagtgatgaagctgaattaaaagttctt
ccagatcctgaggtcacatcaaacttggtatttttgaaacaaccttcttccctggtcaga
gtcattggtcagagtgcagtattgccatgtgttgcttcgggacttcctcttccaaccatt
agatggacaaaaaatgaggaggcacttgacacagaaagctctgaaagattggtattgctg
ccaggtggtagtctggagatcagtgatgtcactgaggacgatgctggtacttatttttgt
gtagctgataatggaaatgaaacagttgaagctcaagcagagcttacagtacaagcccaa
cctgaattcctgaagcagcctactaatatatatgctcatgaatctatggatattgtattt
gaatgtgaagtgactgggaaaccagttccaactgtgaagtgggtcaagaatggggatatg
gttatcccaagtgattactttaaaattgtaaaggaacataatcttcaagttttgggtctg
gtgaaatcagatgaaggtttctatcaatgcattgctgagaatgatgttggaaatgcacaa
gctggagcccaactgataatccttgaacatgatgttgccatcccaacattacctcccact
tcactgaccagtgccactactgaccatctagcaccagccacaacgggaccactgccttca
gctcctcgggatgtcgtggcctctctggtctctacccgcttcatcaaactgacgtggcgg
acacctgcatcagatcctcatggagacaatcttacctactctgtcttctatgccaaggag
gggattgctagggaacgtgttgagaataccagtcacccaggagaaatgcaagtaaccatt
caaaatctaatgccagcgactgtgtatatcttcagagtgatggctcataacaagcatggc
tctggagagagttcagctcctcttcgagtagaaacacagcctgaagttcagctccctggc
ccagcacctaacatccgcgcatatgccacttcccctacttccatcactgtcacctgggaa
acaccattgtctggcaatggggaaattcagaattacaaattgtactacatggaaaaaggg
actgacaaagaacaggatgttgatgtttcaagtcattcccataccattaatgggttgaaa
aaatacacagagtatagtttccgagtggtggcctacaataaacatggtcctggagtctcc
acacaagatgttgctgttcaaacatcatcagatgttcccagtgctgctcctcagaatctg
tccttagaagtaagaaattcaaagagtattatgattcactggcagccacctcctccagcc
acacaaaatgggcagattactggctacaagattcgctaccgaaaggcctcccgaaagagt
gatgtcactgagaccttggtgcctgggacacagctctctcagctgattgaaggtctggat
cgggggactgaatataattttcgagtggctgctctaacagtaaatggcacaggcccggct
actgactggctgtctactgaaacttttgaaagtgacttagatgaaactcgtgttcctgaa
gtacctagttctcttcatgtccgcccacttgtcaccagcatcgtagtaagctggactcct
ccagagaaccagaacattgtggtcagaggttatgccattggttatggcattggcagccca
catgcacagaccatcaaagtggactataaacagcgctattacaccatcgaaaatctggat
cccagctctcactatgtgattaccttaaaagcattcaacaatgtgggtgaaggcatcccc
ctgtatgagagtgctgtgaccagacctcacacagtgccagatcccactcccatgatgccg
ccagtgggagtccaggcttccattctgagtcatgacaccataaggattacgtgggcagac
aattcactgcccaaacaccagaagattacagactcgaggtactacacagtccgatggaaa
accaacatcccagcaaacaccaagtacaagaatgcaaatgcaactactttgagttatttg
gtgactggtttaaaagcaaatacactctatgaattctctgtgatggtgaccaaaggtcga
agatcaagcacatggagtatgacagcccatgggaccacctttgaattagttcctacttct
ccgcccaaggatgtgacagttgtgagtaaagagggaaaacctaggaccataattgtaaat
tggcagcctccttctgaagccaatggcaaaattacaggttacatcatatattacagcaca
gatgtgaatgcagagatacatgattgggttattgaacctgttgtgggcaacaggctgact
caccagatacaggagctaacactggacacaccgtactacttcaaaatccaggctcggaac
tcaaagggcatggggcccatgtctgacgctgtgcaatttagaacacctaaagcctcaggg
tctgcaggaaaaggaagccggctgccagacctgggatctgactacaaacctcccatgagc
ggcagtaacagcccccatggaagccccacctctcctctggacagtaatatgctactggtc
atcatcatctctgttggggtcatcaccatcgtggtggttgtggtcattgctgtcttttgc
accaggcgcaccacctctcaccagaaaaagaaacgagctgcttgtaagtcagtgaatggc
tcccacaagtacaaagggaactccaaagatgtcaaacccccagacctctggatccatcat
gagagactggagctgaaacccattgataagtctccagatccaaatcccatcatgactgat
actccaattcctcgtaactctcaagatattacaccagttgacaattccatggacagcaac
atccatcaaaggcggaattcatacagagggcatgaatcagaggacagcatgtctacactg
gctggaaggcggggaatgagaccaaaaatgatgatgccctttgactctcagccaccccag
cctgtgattagtgcccatcccatccattccctcgataacccccaccatcatttccactcc
agcagcctcgcttctccagctcgcagtcatctctaccacccaggcagcccatggcccatt
ggcacatccatgtccctttcagacagggccaattccacagaatctgttcgaaataccccc
agcactgacaccatgccagcttcctcgtctcagacatgctgtactgatcaccaagatcct
gaaggtgctaccagctcctcttatttggccagctcccaagaggaagattcaggccagagt
cttcctaccgcccacgttcgcccttcccacccactgaagagctttgctgtgccggccatt
ccacccccaggtcctcccacctatgatccggcgctgccaagcacaccattactgtcccag
caagctctgaaccatcacattcactcggtgaagacggcctccattgggactttaggaagg
agcaggcctcctatgcccgtggtggttcccaatgcccctgaagtgcaggagaccacaagg
atgctggaagactccgaaagtagctatgaaccagatgagctgaccaaagagatggcccac
ctggaaggactaatgaaggacctaaatgccatcacgacagcatga

DBGET integrated database retrieval system