KEGG   Miniopterus natalensis (Natal long-fingered bat): 107528573
Entry
107528573         CDS       T05883                                 
Symbol
UGGT1
Name
(RefSeq) UDP-glucose:glycoprotein glucosyltransferase 1
  KO
K11718  UDP-glucose:glycoprotein glucosyltransferase [EC:2.4.1.-]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107528573 (UGGT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107528573 (UGGT1)
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     107528573 (UGGT1)
Glycosyltransferases [BR:mna01003]
 Others
  Quality control
   107528573 (UGGT1)
SSDB
Motif
Pfam: Glyco_transf_24 Thioredoxin_14 Thioredoxin_15 Thioredoxin_12 UDP-g_GGTase Thioredoxin_13 Glyco_transf_8
Other DBs
NCBI-GeneID: 107528573
NCBI-ProteinID: XP_016057175
LinkDB
Position
Unknown
AA seq 1531 aa
MGLLTVFTGLWLFSLVKADSKAITTSLTTKWFSTPLLLEASEFLAEDSQEKFWSFVEASH
NIGSSGHHGTDYSYYHAILEAAFQFLSPLQQNLLKFSLSLHSYSATIQAFQQIAADEPPP
EGCNSFFSVHGRKTCDFDTLETLLLTAPERPKPLLFKGDHRYPSSSPESPVVIFYSEIGY
ESFYNFHRQLVSKSNAGKISYIFRHYISTPRKEPVYLSGYGVELAIKSTEYKAKDDTQVK
GTEVNTTVIGDNDPIDEVQGFLFGKLRDLHPDLKGQLKELRKHLVESTNEMAPLKVWQLQ
DLSFQTAARILAAPIELALVVMKDLSQNFPTKARAITKTAVSSELRSEVEENQKYFKGTL
GLQPGDSALFINGLHIDLDTQDIFSLFDVLRNEARVMEGLHRLGIEGLSLHNVLKLNIQP
SEADYAVDIRSPAISWINNLEVDARYNSWPSSLQELLRPTFPGVIRQIRKNLHNMVFIVD
PAHETTAELINTAEMFLSNHIPLRLGLIFVVNDSEDVDGMQDAGVAIMRAYNYVAQEVDD
YHAFQTLTHIYNKVRTGEKVKVEHVVSVLEKKYPYVEVNSILGIDSAYDQNRKEARGYYE
QAGVGLLPVVLFNGMPLEKEQLDPDELETITMHKILETTTFFQRAVYLGELSHDQDVVEY
IMNQPNVVPRINPRILTVEREYLDLTATNNFFVDDYARFTVLDSQGKTAAIANSMNYLTK
KGMSSKEIYDDSFIRPVTFWIVGDFDSPSGRQLLYDAIKHQKSSNNVRIGMINNPGDDIN
YENMQISRAIWAALQTQTSNSAKNFITKMAKEETAEALAAGTDIGEFSVGGMDFSLFKEV
FEASKMDFILSHAMYCRDVLKLKKGQRAVISNGRIIGPLEDNELFNQDDFHLLENIILKT
SGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKGEARVEYQFFEDRHSAIKLRPKEGE
TYFDVVAVIDPVTRESQRLAPLLLVLTQLINMNLRVFMNCQSKLSDMPLKSFYRYVLEPE
ISFTSDNSFAKGPIAKFLDMPQSPLFTLNLNTPESWMVESVRTPYDLDNIYLEEVDGIVA
AEYELEYLLLEGHCYDITTGQPPRGLQFTLGTSANPVIVDTIVMANLGYFQLKANPGAWI
LRLRKGRSEDIYRIYSHDGTDSPPDAGDVVVVLNNFKSKIIKVKVQKKADMVNEDLLSDG
TNENESGFWDSFKWGFTGGQRAEEVKQDKDDIINIFSVASGHLYERFLRIMMLSVLKNTK
TPVKFWFLKNYLSPTFKEFIPYMADKYSFQYELVQYKWPRWLHQQTEKQRIIWGYKILFL
DVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPYGYTPFCDSRKEMDGYRFWKSGYW
ASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQV
PIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQELKQL
QVRFQKEKERAAQGEEMTQEPRQGPQTREEL
NT seq 4596 nt   +upstreamnt  +downstreamnt
atgggacttctgactgtattcactggactgtggctgttttccttagtaaaggcagattca
aaagccatcacaacttctcttacaacaaaatggttttccactcctttgttattagaagcc
agtgagtttttagcagaagacagtcaagagaagttttggagttttgtagaagccagtcac
aatattggatcatcaggtcatcacggtactgattattcctattatcatgcaatattagaa
gctgcatttcaatttctgtcacctctacagcagaatttgttgaagttttctctgtctctc
cattcctactctgctacaattcaagccttccagcagatagcagctgatgaacctccacca
gaaggatgtaactcgtttttttcagtgcatggaaggaagacctgtgattttgataccctt
gagactcttctactaacagcacctgaaagacccaaacccttattgttcaaaggcgatcac
agatacccctcatctagtcctgagagtccagtggtgattttctactctgagatcggctat
gagtcattttataatttccaccgccagcttgtatcaaaaagcaatgcaggcaaaatcagt
tacatattcagacattatatatcgacccccagaaaagagcctgtttatctctccggctat
ggtgtggaactggccattaagagcactgagtacaaggccaaggatgatactcaggtgaaa
ggaactgaagtaaacaccacagtgatcggtgataatgatcctattgatgaagttcaagga
tttctctttggaaaattaagagacctacaccctgacctgaagggacagttgaaagaactt
agaaagcatcttgtggagagcaccaatgaaatggcacctttaaaagtttggcaattgcaa
gatctaagtttccagactgctgcccgaatcttggctgctcctattgaattggctttggtg
gtgatgaaggatcttagtcaaaattttcctaccaaagccagggcaataacaaaaacagct
gtgagttcagagcttagatctgaagtggaagagaatcagaagtatttcaagggaacttta
ggattacagcctggagactcagcactgttcatcaatggacttcatattgacttagatacg
caggatatattcagtctctttgatgtattgaggaatgaagcccgggtcatggagggtcta
catagactgggaatagaaggtctttctctgcataatgttttgaaactgaacatccagccc
tctgaggccgactatgctgtagacatcaggagtcctgctatttcgtggatcaacaacctg
gaggttgatgccagatataattcatggccttctagtctacaggagttgcttcggcccact
tttcctggtgttatccggcagatccggaaaaatttgcataacatggttttcatagttgat
cctgctcatgagaccacagcagagttgattaacacagctgaaatgttcctcagtaatcat
ataccactaagactcggtttaatctttgtggttaatgattctgaagatgtggatgggatg
caagatgctggagtggctattatgagagcatataattatgttgcccaagaagtggatgat
tatcacgccttccagactctgacacatatatataacaaagtaaggactggagaaaaggtg
aaagtcgaacatgtggtcagtgtcctggagaagaaatacccatatgtagaagtgaacagc
attttggggatcgattctgcttatgatcagaatcggaaggaagcaagaggctactacgag
caggctggagttggtctgctgcctgttgttctgttcaatggaatgccccttgaaaaggag
cagctagatcctgatgaattggaaaccatcacaatgcacaaaatcctggagactaccacc
ttcttccaaagagcagtgtacttgggtgaactgtcccacgatcaagatgtggtagagtat
attatgaatcagccgaatgttgttccacgaatcaaccctaggattttgacggttgagcga
gaatacctggatttaacagcaaccaataacttttttgtggatgactatgctagatttact
gttttggattctcaaggcaagactgctgctatagctaatagtatgaactatctgacaaag
aaagggatgtcctccaaggaaatctatgatgattcttttattaggccagtaactttttgg
attgttggggattttgatagcccctctggaaggcaattattgtatgatgctattaaacat
cagaaatccagtaacaatgttaggataggcatgatcaataatcctggtgatgacataaat
tatgagaacatgcagatctccagagcaatctgggcagctcttcaaacacagacctccaac
tctgctaagaacttcattacaaaaatggccaaggaggagactgcggaggccctggctgca
ggaactgatattggggagttctctgttgggggcatggatttcagtctttttaaagaggtc
tttgaagcttccaaaatggatttcattttgtctcatgccatgtactgcagggatgtcctg
aagctgaagaagggacagagggcagtgatcagcaatggaaggatcattgggccactggag
gataatgaactctttaatcaagatgatttccacctcctggaaaatatcatcttaaaaact
tcaggacagaaaattaaatctcatattcaacagcttcgggtagaagaagatgtggcaagt
gacttggtaatgaaggtggatgctctcctatcagctcaaccaaaaggggaagcaagagtc
gagtaccagttttttgaagacagacacagtgcaattaaactgaggccgaaagaaggagag
acgtactttgatgtcgtggctgtcattgaccctgtcaccagagaatcgcagagacttgcc
ccattgctcttggtgttaactcagctgatcaacatgaatctaagagtatttatgaactgc
cagtctaaactttctgacatgcctttaaaaagcttttaccgttatgtcttagaaccagag
atttctttcacttcagacaacagttttgctaagggtccaatagccaaatttttggatatg
ccacagtctcctctgttcactctgaatttgaacacacctgagagttggatggtggagtct
gtcagaactccatatgatctggataatatttatttagaagaggtggacggcatagtggct
gctgagtacgaactggagtacctcttactagaaggtcactgctatgatatcaccacaggg
cagcctccacggggactacagtttacattaggaacttcagccaacccagtcattgtggat
accattgtgatggccaatctgggttactttcagttaaaagccaacccaggagcttggatt
ctcagactaaggaagggacgttccgaagatatttacaggatctatagccatgatgggaca
gactctccgcccgatgctggtgacgtggtggttgtcctcaataactttaagagcaaaatt
attaaagtgaaggttcagaagaaggcggacatggtgaacgaggacttgctgagcgatggg
actaatgagaatgagtctggattttgggattccttcaaatggggcttcaccggaggacag
agggctgaggaagtgaaacaggataaagacgacataattaatattttctctgttgcatct
ggtcatctctatgagaggtttcttcgcataatgatgttatcagtgctgaagaataccaag
actcctgtgaaattctggtttttgaagaattatttgtctcccacatttaaggagtttata
ccttatatggcagacaaatacagtttccagtatgagcttgtccagtacaaatggccccgg
tggcttcaccaacagaccgaaaagcagcgcatcatctgggggtacaagatcctcttcctg
gacgtgctcttccccctggttgtcgacaagttcctgtttgtcgatgctgaccagatcgta
cgaacagatctgaaagagttaagagatttcaatttggatggtgccccttatggttatact
cctttctgtgacagccgaaaagaaatggatggctacaggttctggaaatcagggtactgg
gccagtcacttagctgggcgcaagtatcatatcagtgcattgtatgttgttgatctgaag
aagttcaggaaaatagctgctggtgacagactcaggggacagtaccaaggtctgagtcag
gatccaaacagtctttcaaatcttgatcaagatttgcccaataacatgatccatcaggtg
ccaattaaatcactgcctcaagaatggctttggtgtgaaacgtggtgtgatgacgcctct
aagaagagggcaaaaacgattgacttgtgtaataatccaatgaccaaagagcccaagctg
gaagcagctgttcgaatcgtcccagagtggcaagactacgaccaagagctcaaacagctg
caggtccgctttcagaaggagaaggaaagggcagcccagggtgaggagatgacacaggag
ccacgccaaggacctcagactcgtgaagagttatga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545896
Entry
107545896         CDS       T05883                                 
Symbol
UGGT2
Name
(RefSeq) UDP-glucose:glycoprotein glucosyltransferase 2
  KO
K11718  UDP-glucose:glycoprotein glucosyltransferase [EC:2.4.1.-]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545896 (UGGT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107545896 (UGGT2)
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     107545896 (UGGT2)
Glycosyltransferases [BR:mna01003]
 Others
  Quality control
   107545896 (UGGT2)
SSDB
Motif
Pfam: Glyco_transf_24 Thioredoxin_14 Thioredoxin_15 UDP-g_GGTase Glyco_transf_8
Other DBs
NCBI-GeneID: 107545896
NCBI-ProteinID: XP_016079633
LinkDB
Position
Unknown
AA seq 1084 aa
MTVSFIQYLGSPIDIKWINDLENDYLYVAWPASCQELLKSLFPGKIPSIRRNFHNLVLFI
DPAQEYTLNFIKLAEVLYYRKIPVRIGFVFIVNTDDEVDGTNDAGVALWRAFNYVAEEYD
VSQAFVFITQMYQKVKSQNIITVDNVKSVLQDKFPQADILDILGINSRYDDKRKAGASFY
KVTGLGPLPQALYNGESLNHEDLNIQKLERALLQKMMDVTIYLQREVFMGTLNDRTNAID
FLMDKNNVVPRINHLILYSEQQYLNLISTSVTADVEDFSTFFFLDSQDKSAVIAENMYYL
TQEDEDVISSVTLWIIADFDKPSGRNMLLNALKHMKTTFRSRLGVIYNPTSKINEENTAI
SRGILAAFLTLKNNFLGNFLRKLAREETATAIYSGDKIKTFLTEGMDKDAFEKKYNTVGV
NIFRTHQLFCQDVLKLRPGERGIVSNGKFLGPLNENFCEEDFFLLEKITFTNLAEKIKGI
VENMAINSKNKSDLVMKVDALVSSLPTPESRYNVAFLKENHSIMKVNPQENDMFFDVIAI
VDPLTREAQMMAQLLIVLGKIINMKLKLFMNCRSKLSEAPLKSFYRFVLEPELTLVSNNV
IEPVAKFLDIPESPLLTLNMITPGGWLVETVHSNCDLDNIHLKDIERTVIAEYELEYLLL
EGHCFDTTTEQSPRGLQFTLGTKNQPVAVDTIVMANLGYFQLKANPGAWILKLRQGKSED
IYQIIGHEGTDSQVDLGDVIVVLNSFKSKILAIQVQKKPDKIKEDILTDKKEKKGMWDSI
KSFTRSLHKEKDKKETDVLNIFSVASGHLYERFLRIMMLSVLRNTKTPVKFWFLKNYLSP
TFKEVIPYMAKEYGFQYELVQYKWPRWLHQQTEKQRIIWGYKILFLDVLFPLAVDKIIFV
DADQIVRHDLKELRDFDLGGAPYGYTPFCDSRTDMDGYRFWKKGYWASHLLRRKYHISAL
YVVDLKRFRRIAAGDRLRGQYQALSQDPNSLSNLDQDLPNNMIYRVAIKSLPQDWLWCET
WCDDESKQRAKTIDLCNNPKTKEPKLKAAVRIVPEWVEYDTEIRQLLDHLENKKKNAILT
HDEL
NT seq 3255 nt   +upstreamnt  +downstreamnt
atgacagtatctttcatccaatatcttggtagcccaatagatataaagtggattaatgat
ttagaaaatgattatttgtatgttgcatggcctgcaagttgccaggaacttctgaaatca
ctattccctggaaaaataccttccataaggcgtaattttcataatttggttctgtttatt
gatcctgctcaagaatataccttgaattttataaaacttgctgaagtgttatattatcgt
aaaattcctgttagaattggttttgtgttcattgttaatacagatgatgaagtcgatgga
acaaatgatgctggagttgctctttggcgggctttcaactatgttgcagaagaatatgat
gtatcacaagcatttgttttcataacacagatgtaccaaaaagtgaagagtcaaaatata
atcacagtggacaatgtgaagagtgttctccaagataaatttcctcaagctgatattttg
gatattttggggattaattctagatatgatgataaaagaaaggcaggagcaagcttttat
aaggtgactggcctgggccctttgcctcaagctctttataatggtgaatccctgaaccat
gaggatttgaatattcaaaaactagaaagagctcttcttcagaaaatgatggatgtgact
atatatttgcaaagggaagtttttatgggcacattgaatgatcgaacaaatgcaattgat
ttccttatggataaaaataatgttgtaccccgtataaatcatttgattttgtacagtgaa
cagcagtacctcaacttaatatctacatcagtaactgcagatgtcgaagatttctctact
ttctttttcttggattcacaagataagagtgctgtaattgcagagaacatgtattattta
acccaagaagatgaagatgtcatttcttcagttactctctggattattgctgattttgac
aaaccatctgggagaaatatgcttttgaatgcattaaagcacatgaaaacaacttttcgt
agtcggttgggcgttatttataatcctacatcaaaaataaatgaagagaacacagctatt
tctagaggaattttggcagcttttcttacactgaaaaacaactttttgggaaactttctc
aggaaactggcaagggaagaaactgctacagctatttactctggagataaaattaaaaca
ttccttactgaggggatggataaggatgcttttgagaaaaaatataataccgttggggtg
aatatttttcgaactcaccagttgttctgtcaagatgtacttaagctgcgtcccggagaa
aggggtattgtcagcaatggcaaattcttaggacctttaaatgaaaatttctgtgaagaa
gatttcttcttattggaaaagataacatttactaacttagcagagaaaattaaaggcatt
gttgaaaatatggcaatcaactcaaaaaacaagagtgaccttgttatgaaagttgatgcc
cttgtttcctctttgcctacacctgagtctcgttataatgttgcatttttaaaagagaat
cacagcattatgaaggtaaatcctcaagagaatgacatgttctttgatgttattgctatt
gttgatccattgacaagagaagcacagatgatggcacagttattgatcgtacttggaaag
attatcaacatgaagttaaagttgttcatgaactgtaggagtaagctttcagaagcccct
ttaaagagtttttaccgatttgttctggaaccggaattgacgttagtgtctaataatgtc
attgaaccagtagcaaagttcttggatatccccgaatcaccccttctaaccctcaacatg
attactcctggaggctggttggttgaaacagtacacagcaactgtgaccttgataatatt
cacttaaaggatattgagagaaccgttatagcagaatatgaactagaatatcttctgctt
gaaggacactgctttgatacgacgacggagcaatctcctcgaggtctgcagttcacactt
ggcacaaaaaatcaacctgttgcagttgatacaatagtgatggccaatcttggatatttt
caattaaaagcaaacccaggtgcttggatactaaaattacgccaaggaaaatctgaagat
atttatcaaataattgggcatgaaggaactgactctcaagtggacctaggagatgtcatt
gtcgtgttaaacagcttcaaaagcaaaatactggcaatacaagtgcaaaaaaagccagac
aaaattaaggaagatatccttactgataaaaaagaaaaaaaaggaatgtgggattccatt
aaaagtttcacaagaagtttgcataaagaaaaagacaaaaaggaaacagacgttctgaac
attttctcagttgcttctggccatttatatgaacgctttttaagaatcatgatgctttct
gttttacgtaacaccaaaacaccagtaaaattctggttcctaaaaaattatctctcacca
acatttaaagaggtaattccttacatggctaaggaatatggattccaatatgaactagtc
caatataagtggccccgctggcttcaccaacagacggaaaaacaaaggattatttggggt
tacaaaattctcttccttgatgtcctttttcctctagcagtggacaaaatcatttttgtt
gatgctgaccagattgtgagacatgacctgaaagaacttcgagatttcgatctgggtgga
gctccttatgggtatactccattttgtgatagccgcactgacatggatgggtatcgtttc
tggaagaaaggatattgggcatcacatcttttaagaaggaaataccatatcagtgcctta
tatgtagtggatctcaagaggttcaggagaattgcagcaggtgacaggctccggggccag
taccaagctctcagtcaagatccaaacagtctttcaaacctagatcaggatcttcccaat
aatatgatttaccgagttgccattaagtctcttcctcaagattggctgtggtgtgaaacc
tggtgtgatgatgaatccaaacaaagagccaaaacaatcgatctgtgcaataatcccaaa
acaaaagaaccgaaactgaaggctgctgtcaggattgtcccagaatgggtggagtatgat
actgagatacgacaactgttagatcaccttgaaaacaagaagaaaaatgcaattttgaca
catgatgaactctag

DBGET integrated database retrieval system