KEGG   Miniopterus natalensis: 107528631
Entry
107528631         CDS       T05883                                 

Gene name
IL1B
Definition
(RefSeq) interleukin-1 beta
  KO
K04519  interleukin 1 beta
Organism
mna  Miniopterus natalensis
Pathway
mna01523  Antifolate resistance
mna04010  MAPK signaling pathway
mna04060  Cytokine-cytokine receptor interaction
mna04064  NF-kappa B signaling pathway
mna04217  Necroptosis
mna04380  Osteoclast differentiation
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04623  Cytosolic DNA-sensing pathway
mna04625  C-type lectin receptor signaling pathway
mna04640  Hematopoietic cell lineage
mna04657  IL-17 signaling pathway
mna04659  Th17 cell differentiation
mna04668  TNF signaling pathway
mna04750  Inflammatory mediator regulation of TRP channels
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04940  Type I diabetes mellitus
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05133  Pertussis
mna05134  Legionellosis
mna05135  Yersinia infection
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05144  Malaria
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05168  Herpes simplex virus 1 infection
mna05171  Coronavirus disease - COVID-19
mna05321  Inflammatory bowel disease
mna05323  Rheumatoid arthritis
mna05332  Graft-versus-host disease
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528631 (IL1B)
   04064 NF-kappa B signaling pathway
    107528631 (IL1B)
   04668 TNF signaling pathway
    107528631 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107528631 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107528631 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107528631 (IL1B)
   04620 Toll-like receptor signaling pathway
    107528631 (IL1B)
   04621 NOD-like receptor signaling pathway
    107528631 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    107528631 (IL1B)
   04625 C-type lectin receptor signaling pathway
    107528631 (IL1B)
   04659 Th17 cell differentiation
    107528631 (IL1B)
   04657 IL-17 signaling pathway
    107528631 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107528631 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107528631 (IL1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107528631 (IL1B)
   05164 Influenza A
    107528631 (IL1B)
   05162 Measles
    107528631 (IL1B)
   05168 Herpes simplex virus 1 infection
    107528631 (IL1B)
   05163 Human cytomegalovirus infection
    107528631 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107528631 (IL1B)
   05135 Yersinia infection
    107528631 (IL1B)
   05133 Pertussis
    107528631 (IL1B)
   05134 Legionellosis
    107528631 (IL1B)
   05152 Tuberculosis
    107528631 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107528631 (IL1B)
   05144 Malaria
    107528631 (IL1B)
   05140 Leishmaniasis
    107528631 (IL1B)
   05142 Chagas disease
    107528631 (IL1B)
   05143 African trypanosomiasis
    107528631 (IL1B)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107528631 (IL1B)
   05321 Inflammatory bowel disease
    107528631 (IL1B)
   05332 Graft-versus-host disease
    107528631 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528631 (IL1B)
   05020 Prion disease
    107528631 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    107528631 (IL1B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107528631 (IL1B)
   05418 Fluid shear stress and atherosclerosis
    107528631 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107528631 (IL1B)
   04932 Non-alcoholic fatty liver disease
    107528631 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107528631 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107528631 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107528631 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107528631 (IL1B)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interleukins
   107528631 (IL1B)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Cytokines
   107528631 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 107528631
NCBI-ProteinID: XP_016057251
LinkDB
Position
Unknown
AA seq 285 aa
MLLILSTVKIVLQEGKTTCLGDIIEQCLCFYSSGHENDLVFEADGPQQTKCYFQDLDLSS
LESGGIQLKISHQLSSSSFRRAVSVVIALEKLRKFPVVCSQDFQDDDLRSLFFLIFVEEP
ITYLYGDSYECDALLQTLNCTLRDVHQKSLVLSGPHELQALHLNTHDTSQQVVFCMSFVP
GDENIDKIPVALGIKEKNLYLSCVMKDKKPILQLETLDPNSQSKKKIDKRFVFNKTEIKD
KVEFESALYPNWYISTSQEEKMPVFLGNSRGGQDITDFTMEILPR
NT seq 858 nt   +upstreamnt  +downstreamnt
atgctgcttatcctgtcaacagtaaagattgttttgcaggaaggaaaaacaacttgtctg
ggagatataattgagcagtgtctctgtttttattccagtggccatgagaatgacctggtc
tttgaggctgatggtccgcaacaaactaagtgctactttcaagacctggacctcagctcc
ctggaaagcgggggcatccaactgaaaatctcgcaccagctcagcagctcgagtttcagg
cgggccgtgtctgtggtcatcgccctggagaagctgaggaagtttcccgttgtctgctcg
caggactttcaggacgacgacctgaggagcctcttttttctcatctttgtggaagaaccc
atcacctacttgtacggtgacagttacgagtgtgatgcactcctgcaaacgctgaactgc
acgctccgggacgtacaccagaaatccctggtgctgtctggaccgcatgagctgcaagct
ctgcacctgaatacacatgatacgagccaacaagtggtgttctgcatgagcttcgtgcca
ggagacgagaatatcgacaagatacctgtggccttgggcatcaaggaaaagaacctgtac
ctgtcttgtgtgatgaaagacaagaagcccattctgcagctggagacattagaccccaac
tctcagtcaaagaagaagatagacaagagatttgtcttcaacaagacagaaatcaaggac
aaggtcgaatttgagtctgccctgtaccccaactggtacatcagcacctcgcaagaggaa
aagatgcccgtcttcctgggaaatagcagaggtggccaggatataactgacttcaccatg
gaaatcctgcctcgctga

KEGG   Miniopterus natalensis: 107528654
Entry
107528654         CDS       T05883                                 

Gene name
IL1A
Definition
(RefSeq) interleukin-1 alpha
  KO
K04383  interleukin 1 alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04060  Cytokine-cytokine receptor interaction
mna04217  Necroptosis
mna04218  Cellular senescence
mna04380  Osteoclast differentiation
mna04640  Hematopoietic cell lineage
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04940  Type I diabetes mellitus
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05133  Pertussis
mna05140  Leishmaniasis
mna05152  Tuberculosis
mna05162  Measles
mna05164  Influenza A
mna05321  Inflammatory bowel disease
mna05323  Rheumatoid arthritis
mna05332  Graft-versus-host disease
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528654 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107528654 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107528654 (IL1A)
   04218 Cellular senescence
    107528654 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107528654 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107528654 (IL1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    107528654 (IL1A)
   05162 Measles
    107528654 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107528654 (IL1A)
   05152 Tuberculosis
    107528654 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107528654 (IL1A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107528654 (IL1A)
   05321 Inflammatory bowel disease
    107528654 (IL1A)
   05332 Graft-versus-host disease
    107528654 (IL1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528654 (IL1A)
   05020 Prion disease
    107528654 (IL1A)
   05022 Pathways of neurodegeneration - multiple diseases
    107528654 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107528654 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107528654 (IL1A)
   04932 Non-alcoholic fatty liver disease
    107528654 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107528654 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107528654 (IL1A)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Interleukins
   107528654 (IL1A)
SSDB
Motif
Pfam: IL1_propep IL1
Other DBs
NCBI-GeneID: 107528654
NCBI-ProteinID: XP_016057272
LinkDB
Position
Unknown
AA seq 267 aa
MAKVPDLFEDLKSCYSENEGYSSDIDQLSLAQKSFYDASYDPLPKECMDKFMSLSTSETS
KTSQLTYKESMVVVAASGKILKRRRLTFNQSMTNNDLDAIANDPEEEILQSTSVPYSSQG
NMRYPFMRVIKQQFILNDALNQSIIRDTSGQLLMATALNNLDQAVKFDMGAYKSNDLKRP
VTLRISETRLFLSAQDKDDPVLLKEMPETPKTITDETNLLFFWETHGTKEYFESVAYPKL
FIATRQEKPVHMASGPPSIIDFQILEH
NT seq 804 nt   +upstreamnt  +downstreamnt
atggctaaggtccctgacctctttgaagacctgaagagctgttacagtgaaaatgaaggc
tacagttctgacattgaccaactctctctggctcagaagtccttctatgatgcaagctat
gacccacttcccaaggaatgcatggacaaattcatgtctctgagtacctctgagacctcg
aagacatcccagcttacctacaaggagagtatggtggtggtggcagccagtgggaagatt
ctgaagaggagacggttgactttcaatcagtctatgaccaacaatgacctggatgccatt
gccaatgatccagaagaagaaatcctccagtccacgtcagtgccttacagctcccagggc
aacatgaggtaccccttcatgagggtcatcaagcaacaattcatcctgaatgacgccctc
aaccaaagcatcattcgagacacatcgggtcaactcctcatggctaccgcattaaataat
ctggaccaagcagtgaaatttgacatgggtgcttataagtcaaatgaccttaaacgtcct
gtgactctaaggatctcagaaacacgactgtttttgagtgcccaggataaagatgatccg
gtattgctaaaggagatgcctgagacacccaagaccatcacagatgagaccaacctcctc
ttcttctgggaaactcatggcactaaggagtatttcgagtcagttgcctatccaaagttg
tttattgccacaaggcaagaaaaaccagtgcacatggcaagtgggccaccctctatcatt
gactttcagatactggagcactag

DBGET integrated database retrieval system