KEGG   Miniopterus natalensis (Natal long-fingered bat): 107528720
Entry
107528720         CDS       T05883                                 
Symbol
EIF2AK3
Name
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 3 isoform X1
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04137  Mitophagy - animal
mna04140  Autophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05160  Hepatitis C
mna05162  Measles
mna05168  Herpes simplex virus 1 infection
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107528720 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107528720 (EIF2AK3)
   04137 Mitophagy - animal
    107528720 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    107528720 (EIF2AK3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107528720 (EIF2AK3)
   05162 Measles
    107528720 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    107528720 (EIF2AK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107528720 (EIF2AK3)
   05012 Parkinson disease
    107528720 (EIF2AK3)
   05014 Amyotrophic lateral sclerosis
    107528720 (EIF2AK3)
   05020 Prion disease
    107528720 (EIF2AK3)
   05022 Pathways of neurodegeneration - multiple diseases
    107528720 (EIF2AK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107528720 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107528720 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107528720 (EIF2AK3)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107528720 (EIF2AK3)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   107528720 (EIF2AK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo ABC1 PQQ_2 APH
Other DBs
NCBI-GeneID: 107528720
NCBI-ProteinID: XP_016057343
LinkDB
Position
Unknown
AA seq 967 aa
MIIPSLDGDLFQWDRDRESMETVPFTVESLLESSYKFGDDVVLVGGKSLTTYGLGAYSGK
VRYICSALGCRQWDSDEMEQEDILLLQRTQKTVRAVGPRSGNEKWNFSVGHFELRYIPDM
ETRAGFIESTLNPTLNKESEIISDVEEQEAATVDTVIKVSVTDWKVMAFSKKGGHLEWEY
QFCTPIASAWLVKDGKVIPISLFDDTSYASNDDVLKDEEDIVEAARGATENSVYLGMYRG
QLYLQSSVRISEKFPTNPKALESVDNENAIIPLPTIKWKPLIHSPSRTPVLVGPDEFDKC
LSNDKFSHEEYSNGALSVLQYPYDNGYYLPYYQRERSKRSTRNTHITVRFLENPNYSKNV
RKKDPVLLLHWWKEIAGTILFCIIATTFIVRRIFHPHPHRQRKESETQCQTENKYDSLSG
ETNDSSWNDMKNSGYISRYLTDFEPIQCMGRGGFGVVFEARNKVDDCNYAIKRIRLPNRE
LAREKVMREVKALAKLEHPGIVRYFNAWLEAPPEEWQEKMDEIWLKDESTDWPLSSPSPM
DAPSVKIRRMDPFSTKEHIEIIAPSSQRSRSFSVGISCGQRSSSESHFSPVEFSGLDWGD
TSESVGAVCNLQDSCLTDCDVDDGTVEGSEEGHSFELCSSGASPSVRSRERTSSSIVFED
SGCDNASSKEEPKTNRLHIGNHCTNKLPPTKHSSSKSSDPTLSISLPRPTTLSLDLTKNT
AEKLQPSSPKVYLYIQMQLCRKENLKDWMNSRCSMEERGLGTCLHIFLQIAEAVEFLHSK
GLMHRDLKPSNIFFTMDDVIKVGDFGLVTAMDQDEEEQVVLTPMPAYPRHTGQVGTKLYM
SPEQIHGNSYSHKVDIFSLGLILFELLYPFGTQMERVRILTDVRDLRFPPLFTQKYPREY
MMVHDMLSPSPTARPEATDIIENAVFEDLEIPGKTVLRQRSRSLSSSGTKHSRQSSDSHS
PLPSSSP
NT seq 2904 nt   +upstreamnt  +downstreamnt
atgatcattccttccctggacggagacctattccagtgggaccgagaccgagagagcatg
gaaacagttccttttacggtcgaatcacttcttgaatcgtcttacaaatttggagatgat
gttgttttggttggaggaaagtctctcactacatatggactcggtgcatatagtggaaag
gtgaggtacatctgttcagctttgggttgtcgccaatgggacagtgatgaaatggaacaa
gaagacatcctgcttctgcaacgcacccagaaaactgttagagctgtcgggcctcgcagt
ggcaatgagaagtggaatttcagtgttggccactttgaacttcggtatattccagacatg
gaaactagagccggatttattgaaagcaccttgaatcctactctgaacaaagagtctgaa
attatctcagatgtggaagaacaggaagctgccacagtggatacagtgataaaagtctct
gttactgattggaaggtcatggcctttagcaagaagggaggacatctggaatgggagtat
cagttttgtactcccattgcatctgcttggttggtcaaggacggcaaagtcattcccatc
agtctttttgatgatacaagttatgcgtctaatgatgatgttttaaaagatgaagaagac
attgtagaagctgcccgaggagccacagaaaacagcgtttacttgggaatgtacagaggc
cagctgtatctgcagtcatcagtcagaatttcagaaaagtttcctacaaatcccaaggcc
ttggaatctgttgataatgaaaatgcaattattcctttaccaacaatcaaatggaaaccc
ttaattcattctccttccaggactcctgtcttggtggggcctgatgagtttgacaaatgt
cttagtaatgataagttttctcatgaagagtacagtaatggcgcgctttcagtcttgcag
tatccatatgataatggttattatctaccatactaccagagggaaaggagcaaacggagc
acaaggaacacacacattacagtcagatttctggagaacccaaattacagcaagaatgtc
cgcaaaaaggaccctgttctcctcttacactggtggaaagaaatagctggaactattctg
ttttgtatcatagcaacaacttttattgtgcgcagaattttccatcctcaccctcacaga
caaaggaaggaatctgagactcagtgtcagactgaaaacaagtatgattctctgagtgga
gaaactaatgacagcagctggaacgacatgaaaaactctggatatatatcacgatatcta
acagattttgagccaattcagtgcatgggtcgtggtgggtttggagttgtctttgaagct
agaaacaaagtggacgactgcaattatgctatcaagagaattcgcctccccaacagggaa
ttggctcgggaaaaggtaatgcgagaagttaaagccttagccaagcttgagcacccagga
atcgtcagatacttcaatgcttggttggaagctccgccagaggagtggcaagaaaaaatg
gatgaaatttggctgaaggatgaaagcacagactggccactcagctctcctagtccaatg
gatgcaccatcagttaaaatacgcagaatggatcctttctccacaaaggaacatattgaa
atcatagctccttcgtcacaaagaagcaggtctttttcagtagggatttcctgtggccag
agaagttcatcggagagccacttctctccagtggaattttctggactggactggggagac
accagtgagtcagtgggtgccgtgtgcaacctccaggacagctgcctcacagactgtgat
gtggatgatggcactgtggaaggcagcgaggaggggcactcctttgaactctgttcttct
ggagcttctccttctgtgaggtccagggagagaacctcctcttccatagtgtttgaagat
tcaggctgtgataatgcgtccagtaaagaagagcccaaaactaaccggctgcacattggc
aaccattgtactaataaactgcctcccaccaaacattccagtagcaaatcttcagaccct
actctgtctatttctcttccaagaccaaccactttaagtcttgatctcactaaaaacact
gcagaaaagctgcagcccagctccccgaaggtatatctttacattcagatgcagctgtgc
agaaaagagaacctcaaggactggatgaacagcaggtgcagcatggaggagagggggctg
ggcacatgcctgcacatcttcctgcagatcgcggaggcggtggagttcctgcatagcaag
gggctcatgcacagggacctcaagccttccaacatattctttacaatggatgacgtgatc
aaggttggagactttggattagtgacggcaatggaccaggatgaggaggagcaggtggtt
ctgaccccaatgccagcatacccccggcacacaggacaagtcgggaccaaactgtatatg
agcccagaacagattcacggaaacagctactctcataaagtggacatcttctcgttaggc
ctcattctgtttgagctgttgtacccatttggcacacagatggagagagtcaggatctta
actgatgtaagagatctcagatttccaccactgtttactcagaaatatcctcgtgagtat
atgatggttcacgacatgctctctccctcccccacggcacggcctgaggctacagacatc
attgaaaacgctgtatttgaggacttggagatcccaggaaaaacagtgctcaggcagagg
tcccgatccttgagctcatctggaacaaaacattcgagacagtccagcgactctcatagc
cctttgccaagcagttcgccttaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107533921
Entry
107533921         CDS       T05883                                 
Symbol
EIF2AK1
Name
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05160  Hepatitis C
mna05162  Measles
mna05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107533921 (EIF2AK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107533921 (EIF2AK1)
   05162 Measles
    107533921 (EIF2AK1)
   05168 Herpes simplex virus 1 infection
    107533921 (EIF2AK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107533921 (EIF2AK1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107533921 (EIF2AK1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   107533921 (EIF2AK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Diphthami_syn_2 Kdo PKcGMP_CC Mito_morph_reg
Other DBs
NCBI-GeneID: 107533921
NCBI-ProteinID: XP_016064288
LinkDB
Position
Unknown
AA seq 529 aa
MGLLSSFSCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDNSHIQKIRSREVAFEAQT
SRYLNEFEELTILGKGGYGRVYKVRNKLDGQYYAIKKILIKGATKTDCMKVLREVKVLAG
LQHPNIVGYHTAWIEHIHVTQMQADRICIQLPSLKVISTQEDDRCQYDVENDESNSSSII
FAELTSEKEKSSVGSGTERQSNRLVNYTPSLVRRDDSEFESSIELQENGLAELSSRSVEN
QLPLRLHSDLEGNFTSTEESSEENLNLAGQTEVQYHLMLHIQMQLCELSLWDWIVERNRR
VRECVDESACPYVMTSVATKIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGD
FGLACADIIQNPDWTSSNGKRTPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSLGVILLE
LFQPFGTEMERARVLTGLRTGQIPESLSQRCPVQAKCIQQLTRRNASQRPSAVQLLQSEL
FQNSGRVNLTLQMKILEQEKEIEELKRQLSRLSQDRGVKEDTKDGGVPI
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggggctgctgtcgtctttcagctgcagcgatgagtttagctcattgaggctgcatcac
aacagagccatcactcatttaatgaggtcagccaaggagagagtgcgtcaggatccttgt
gaggataattctcatatccagaagatcagatcaagggaagtcgcctttgaagcacagact
tcacgttacttaaatgagtttgaagagcttaccatcttaggaaagggtggatatggaaga
gtatacaaggtcaggaataaattagatggccagtattatgcgattaagaaaatcctgatt
aagggtgcaactaagacagattgcatgaaggtactacgggaagtgaaggtgctggcgggt
cttcagcatcctaacattgtgggctatcacactgcctggattgagcacattcatgtgacc
caaatgcaagcagatagaatttgtattcagttgccatctctgaaagtgatctctacccag
gaggatgacaggtgtcagtacgatgttgaaaatgatgagagcaatagctcatccattatc
ttcgccgagctcacctcagaaaaagaaaagtcctcagtaggatctggcactgaacgtcag
agtaacagattggtgaactacacccccagcctcgtcagaagagatgacagtgaatttgaa
tcatccattgagctccaggaaaatggcttggctgagttgtcttccagatcagttgagaat
cagctgccacttaggcttcattcagacttagaggggaatttcacatccactgaggaatct
tctgaagaaaacttaaacttggcaggacagaccgaggttcagtaccacctgatgctgcac
atccagatgcagctgtgcgagctctctctgtgggactggatcgtggagaggaaccggcgg
gttagggagtgtgtggacgagtctgcctgtccatatgttatgaccagtgttgcaacaaaa
atttttcaagaattggtggaaggtgtattttacatacataacatggggattgtgcacagg
gacctgaagcccagaaatatttttcttcatggccctgatcagcaagtgaaaataggagac
tttggtctggcctgcgcagacatcatacagaatccagactggaccagcagtaatggaaag
aggacaccgacacatacctccagagtggggacctgtctgtacgcgtctcccgagcagttg
gaaggatctgagtatgatgccaagtccgacatgtacagcttgggtgtgatcctgttggag
ctcttccagccttttggaacagaaatggagcgagcgcgggtcctaactggtttgagaact
ggtcagatacccgagtccctcagtcagaggtgtcccgtccaagccaagtgcatccagcag
ctaaccaggaggaacgcatcccagaggccgtctgccgtgcagctgctgcagagcgagctt
ttccaaaattccggaagggttaatctcactctgcagatgaagatactagagcaggaaaaa
gaaattgaagaactaaagaggcagctaagccgcctctctcaggacagaggggtcaaggag
gacacgaaagacgggggtgttcccatttag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107541819
Entry
107541819         CDS       T05883                                 
Symbol
EIF2AK2
Name
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase isoform X1
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04217  Necroptosis
mna05010  Alzheimer disease
mna05160  Hepatitis C
mna05162  Measles
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05171  Coronavirus disease - COVID-19
mna05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107541819 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107541819 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107541819 (EIF2AK2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107541819 (EIF2AK2)
   05171 Coronavirus disease - COVID-19
    107541819 (EIF2AK2)
   05164 Influenza A
    107541819 (EIF2AK2)
   05162 Measles
    107541819 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    107541819 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541819 (EIF2AK2)
   05169 Epstein-Barr virus infection
    107541819 (EIF2AK2)
   05165 Human papillomavirus infection
    107541819 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107541819 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107541819 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107541819 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107541819 (EIF2AK2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107541819 (EIF2AK2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   107541819 (EIF2AK2)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107541819 (EIF2AK2)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107541819 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm ABC1 DND1_DSRM Kdo
Other DBs
NCBI-GeneID: 107541819
NCBI-ProteinID: XP_016074488
LinkDB
Position
Unknown
AA seq 527 aa
MADDLSLGFFIGELNKYCQKNNVDVNYHEVSKTGPPHDLRFTIKVIIDGREFPEAEGKPK
KEAKNAAAKLALEILNKEKQDVSSSSLSTIDTSDFNYIGYLNSIAQKERVSINYEQREVC
TSGPERFSCKIKIGEKEYGDAVGTTKQKAKHLAAKRTYEQIKLEKSSKKDDSGFLAFSPA
GSSDYGSDSSIISVSESPSENGVSASGSGRNANSDSVTSSPSSVMGVRKRLEKVKINLAP
TFYSPGKHTSDIRFLKDFPEITQIGSGAYGHIFKAKHRLDGKTYAVKRVKYDDNRKAERE
VQVLATLNHPNIVRYYNSWEGNDYNPEDSNKRLTKCLFIQMEFCDEGTLEEWIDQRRNQK
TNKYLSLEFFEQIAVGVNYIHSKKLIHRDLKPSNIFLVDGKQIKIGDFGLVTFQKHSEKR
TEDQGTPLYMSPEQLQSSPEYGNEVDIFALGLILAELLYITCTRVETVKIFEDLRNGRFS
DIFDDREKILLQKLLAKEPGKRPKTPEILKTLKEWKGIPEKKMRNTR
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggccgacgatctttcattaggttttttcataggagaacttaataaatactgtcagaaa
aacaacgtagatgttaactatcatgaagtgtctaagacaggacctccacatgacttaagg
tttacgattaaggttataatagacgggagagaatttccagaagctgaaggcaaaccaaag
aaggaagcaaaaaatgctgcagccaaattagctcttgaaatacttaataaagaaaaacag
gatgttagttcatcatcactgtcgacaatcgatacttcagattttaattacataggttat
cttaatagtattgcccaaaaggaaagagtgtctataaattatgaacaacgtgaagtttgc
acaagtgggcccgaaagattttcttgtaaaatcaaaattggagagaaagaatacggcgat
gctgtaggtactactaagcagaaggcaaaacatttggctgctaaacgtacatatgagcag
ataaaattagaaaaaagctcaaagaaagatgattcaggattccttgccttttcccctgct
gggtccagtgactacggaagcgactcctcgataatatctgtttctgaatcaccatctgaa
aatggtgtttcagcaagtggatcaggaagaaatgctaacagtgacagtgttaccagttct
ccttcatctgtgatgggtgtcagaaaacggctggagaaggtgaaaataaatttggcccct
accttttactctcctggaaagcatacttcggacatccggtttctcaaggattttccagaa
ataacacagattggctcaggtgcatatggccatattttcaaagcaaaacacagacttgat
gggaagacttacgccgttaaacgtgttaaatacgatgacaacaggaaggcagagcgtgaa
gtacaagttttggcgacgctgaatcatcccaatatagttcgctactataatagttgggaa
ggaaatgattataatcctgaggacagcaacaaaagattgactaagtgccttttcatccaa
atggaattctgcgatgaagggacattggaagaatggattgaccaaagacgaaaccagaaa
acaaacaaatacctgtctttggaattttttgaacaaatagcagtaggagtgaattatata
cattcaaagaagttaattcacagagatcttaagccaagtaacatatttttagtagatgga
aaacaaataaagattggagactttggacttgtaacattccagaaacatagtgaaaagcgg
acagaggaccagggaactccactatacatgagcccggaacagctccagtcttcaccagaa
tatggaaacgaagtggacatctttgctttggggctaattcttgcagaacttctttatata
acttgcactcgtgtggaaacagtgaagatttttgaagatctcaggaatggccgtttctca
gatatatttgatgacagagaaaaaattcttctacagaaattacttgcaaaagaacccggg
aaacgacctaaaacacctgaaatactgaagactttgaaggagtggaagggcattccagag
aaaaagatgcgaaacacgcgttag

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107542988
Entry
107542988         CDS       T05883                                 
Symbol
EIF2AK4
Name
(RefSeq) eIF-2-alpha kinase GCN2
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04140  Autophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna05160  Hepatitis C
mna05162  Measles
mna05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107542988 (EIF2AK4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107542988 (EIF2AK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107542988 (EIF2AK4)
   05162 Measles
    107542988 (EIF2AK4)
   05168 Herpes simplex virus 1 infection
    107542988 (EIF2AK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107542988 (EIF2AK4)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107542988 (EIF2AK4)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   107542988 (EIF2AK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like APH ABC1
Other DBs
NCBI-GeneID: 107542988
NCBI-ProteinID: XP_016075882
LinkDB
Position
Unknown
AA seq 1643 aa
MAGGRGAPGRGRDEPQESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLY
PQGLAGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLDEVAKKHCGE
VMIFELAYYVQSFLTEHNKPPPKSFHEEMLERQAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASFSNQDHTSRKDPGGHRTATMLHGGSPDFVGNGKHR
TSSSGRSRRERQYSVCSSEDSPGSCEILHFSMGNPDQLMVHKGKCIACDEQLGKLVYNAL
ETATGSFVMLYEWVLQWQKKIGPFLTSQEKEKIDKCKKQIQGAETEFNSLVKLSHPNVVR
YFAMNLKEQDNSIMVHILVEHFNGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNS
VVHKVLSTSNVLVDAEGTIKITDYSISKRLADICKEDVFEQTRVRFSDSALPYKTGKKGD
VWHLGLLLLSLSQGQECREYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLLEQTPEDSGGQDYIETVIPSNQLPSAAFFSETQRQFSRYFNEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRHFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAGQGTSSESTEDXXLRAGDSDRDTPDSVEAAAPPPITSSVEWSTSAERSASARFPASG
QGSSSDEDEDEDERDGVFSQSFLPASDSESDIIFDNEDENSKSHNQDKDCNGKNSCHESE
SSTTTEAVHYLYIQMEYCEKSTLRDTIDQGLYQDTIRLWRLFREILDGLAYIHEKGMIHR
DLKPVNIFLDSDDHVKIGDFGLATDHLAFAADGKQDDASGDHLIKSDPSGHLTGMVGTAL
YVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTLPKFPEDF
DDGEHTKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLANVDGKA
YRNMMAQIFSQRIPPAIDYTYDSDILKGNFSVRTAKIQQHVCETIVRIFKRHGAVQLCTP
LLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYCIERVFRPR
KLDRFHPKELLECAFDIITSTTNSSLPTAEVIYTIYEIIQEFPALQERNYSVYLNHTMLL
KAILLHCGIPEDKLSQVYIILYDAVTEKLTRREVEAKFCNLSLSPNSLCRLYKFIEQKGD
LQDLTPTINSLIKQKTGVAQLVKYGLKDLEEVVGLLKKLGIKLQVLINLGLVYKVQQHSG
IIFQFVAFIRRRQRAISEILAAGGRYDLLIPQFRGPQALGPVPTAIGVSIAIDKISAAVL
NMEEPVTISSCDLLVVSVGQMSMSRAINITQKLWTAGITAEIMYDWSQSQEELQEYCRHH
EITYVALVSDKEGSHVKVKSFEKERQTEKRVLESDLVDHVVQKLRTKVSDERTIREASDN
LAVQNLKGSFSNASGLFEIHGTAVVPTVSVVAPEKLSASTRRRYETQVQTRLQTSLANLH
QKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCDEIYNI
KVEKKVSVLFLYSYRDDYYRILF
NT seq 4932 nt   +upstreamnt  +downstreamnt
atggctgggggtcgtggggctcccggtcgcggccgggacgagccgcaggagagctaccca
cagcgacaggaccatgagctgcaggccctagaggccatctacggcgccgacttccaggac
ctgcggccggacgcgtgcggaccggtcaaagagccccctgaaatcaatttagttctatac
ccccagggcctggctggtgaagaagtatatgtaaaagtggatttgagggttaaatgccca
ccaacctatccagatgtagttcctgaaatagagttaaagaatgccaaaggtctgtcaaat
gaaagtgttaatttgttaaaatcccgcctggatgaagtggccaaaaagcattgtggagag
gtgatgatatttgaactggcttattacgtgcaatcatttctcaccgagcataacaagccc
cctcccaagtcttttcatgaagaaatgctggaaaggcaggctcaggaggagcagcagagg
ctattagaggccaagcggaaagaggagcaggagcaacgtgaaatccttcatgagattcag
agaaggaaagaagagatcaaagaagagaaaaaaaggaaagagatggccaagcaggaacgt
ttggaaattgctagtttttcaaaccaagatcatacctctaggaaggacccaggaggacac
agaacagctaccatgctacatggaggctctcccgacttcgtaggaaatggtaaacatcgg
accagctcctctggaaggtccaggcgagagcggcagtattctgtatgtagtagtgaagat
tctcctggctcttgtgaaatccttcatttctctatgggtaatcctgatcagctcatggtg
cacaaaggaaaatgtattgcctgtgatgaacagctcggaaaactagtttacaatgctttg
gaaacagccactggcagcttcgtcatgttgtatgagtgggtccttcagtggcagaaaaaa
attggtccttttcttaccagtcaagaaaaagagaagattgataagtgcaaaaagcagatt
caaggggcagaaacagaattcaactcgctggtaaaactgagccatcccaatgtagttcgc
tactttgcaatgaatctcaaagagcaagacaactccatcatggtgcacattttggtggag
cactttaatggggtctcccttgctgcacacctgagccactcaggccccatccctgtgcat
cagcttcgcaggtacacagctcagctcttgtcgggcctcgattatttgcacagcaattcc
gtggtgcacaaggttctgagtacatcgaatgtcttggtggacgcagagggcaccatcaag
attacggactacagcatttctaagcgcctagcagacatttgcaaggaggatgtgtttgag
caaacccgagttcgtttcagcgacagcgccctgccttataaaacagggaagaaaggggat
gtttggcatcttggcctgctgctgctctccctcagccaagggcaagaatgtagagagtac
cctgtgaccatcccgagtgacttacctgctgactttcaagattttctaaagaaatgtgtt
tgcctggatgacaaggaaagatggagtcctcagcagctgttgaaacacagctttataaat
cctcagccaaaaatgcctctgctggaacaaactcctgaagattctggaggacaagattac
atcgaaactgttattcctagcaaccagctacccagcgctgcattcttcagtgagacccag
aggcagttttcccgctatttcaatgagtttgaagaattacagcttctcggcaaaggagct
tttggagctgtcatcaaggtgcagaacaagctggacggctgctgctacgcagtgaagcgc
atccccatcaacccggccagcaggcacttccgcaggatcaagggcgaggtgacgctgctg
tcgcgcctgcaccatgagaacatcgtgcgctactacaacgcctggattgagaggcacgag
cggccggccggccagggcacctcgtccgagagcaccgaggacnnnnnnctgcgggcgggc
gacagcgacagggacaccccggacagcgtggaggccgccgcgccgccgcccatcaccagc
tcggtggagtggagcacttcggccgagcgctcggccagcgcgcgcttccccgcctcgggc
cagggctccagcagcgacgaggacgaggacgaggacgagcgcgacggcgtcttctcgcag
tccttcctacctgcttcagattctgaaagtgatatcatctttgacaatgaagatgagaac
agtaaaagccataatcaggataaagactgcaatggaaagaacagttgccatgaaagtgag
tcatcgacaaccactgaagctgtgcactacctctatatccagatggagtactgtgaaaag
agcactttacgcgataccattgaccagggactgtatcaggacaccatcagactctggagg
ctttttcgagagattctggatggattggcttatatccatgagaaaggaatgattcaccgg
gatttgaagcctgtcaacatttttttggattccgacgaccatgtgaaaataggtgatttt
ggtttggcgacagaccatctagcctttgccgctgatggcaaacaagatgatgcatcagga
gatcatttaattaaatcagacccttcaggtcatttgactgggatggttggcactgctctg
tatgtaagcccagaggtccaaggaagcaccaaatctgcatacaaccagaaagtggatctc
ttcagcctgggaatcatcttctttgagatgtcctatcaccccatggtcacagcctcagaa
aggatctttgttctcaaccaactcagagatcccactttgcctaagtttccagaagacttt
gatgatggagaacatacaaagcagaagtctgtcatctcctggctgttgaaccacgatcca
gcaaagcggcccacagccacggaactgctcaagagcgagctgctgcccccgccccagatg
gaggagtcggagctgcacgaggtgctgcaccacaccctggccaacgtggacgggaaggcc
tatcgcaacatgatggcccagatcttctcgcagcgcatcccgcctgccatcgattacacc
tatgacagcgacatactgaagggcaacttttcagtccgtacagccaagatacagcagcat
gtgtgtgaaaccattgtccgcatctttaaaagacatggagctgtccaattgtgtacccca
ctactgctcccccgaaataggcaaatatacgagcacaacgaagccgccttattcatggac
cacagcgggatgctggtgatgcttcctttcgacctgcgggttccttttgcaagatatgtg
gcaagaaataatatattgaacttaaaacgatactgcatagaacgtgtcttcagacctcgc
aagttagaccgatttcatcccaaagaacttctggaatgtgcttttgatatcatcacctct
accaccaacagctctctgcccactgctgaagtcatctataccatctatgaaatcatccag
gagtttccggcccttcaggaaagaaattacagtgtgtacttgaaccacaccatgttattg
aaagcaatactcttacactgtgggatcccggaagataaactcagccaggtctacattatt
ctgtatgatgccgtgacagaaaagctgacgaggagagaagtggaagctaaattttgcaat
ctgtctttgtctcctaatagtctgtgtcgactctacaaatttattgagcagaagggagat
ttgcaagatttaacaccaacaataaattcattaataaaacaaaaaacgggtgttgcccag
ctggtgaagtatggcttaaaagatctagaggaggttgttggactgttgaagaaacttggc
ataaagttacaggtcttgatcaatttgggcttggtttacaaagtgcagcagcacagcggg
atcatcttccagtttgtggcgttcatcaggcggaggcagagggctatctctgaaatcctt
gcagccgggggcagatacgacctgctgattccccagtttagaggaccacaggctctgggg
ccagttcccactgccattggggtcagcatagctatagacaagatatctgctgctgtcctc
aacatggaagaacctgttacaataagctcttgtgacctcctggttgtaagtgtcggtcag
atgtccatgtccagggccatcaacataacccagaaactctggacggcgggaatcacagca
gaaatcatgtatgactggtcacagtcccaagaggaattacaggaatactgcagacatcat
gaaatcacctatgttgccctcgtctcagataaagaaggaagccacgtcaaggttaagtct
tttgagaaggagaggcagacagagaagcgtgtgctggagtctgaccttgtggaccacgtt
gtgcagaaactgaggactaaagtcagtgatgaaaggactatcagagaagcttccgataat
cttgcagtacaaaacctgaaggggtcgttttctaatgcttcaggcctgtttgaaatccat
ggaacagcagttgttcccactgtgagtgtggtagccccggagaagctgtcagccagcact
aggcggcggtatgaaactcaggtacaaacccgacttcagacctcccttgccaacttacat
cagaaaagcagtgaaattgaaattttggctgtggatctacccaaagaaacaatcttacaa
tttttatcattagagtgggatgctgatgaacaggcatttaacacaactgtgaagcagctg
ctgtcacgcctgccaaagcaaagatacctgaaattagtctgtgatgaaatttataacatc
aaagtagaaaaaaaggtgtccgtgctattcctgtatagctacagagatgactactacaga
atcttattttaa

DBGET integrated database retrieval system