KEGG   Miniopterus natalensis: 107529039
Entry
107529039         CDS       T05883                                 

Gene name
SSB
Definition
(RefSeq) lupus La protein
  KO
K11090  lupus La protein
Organism
mna  Miniopterus natalensis
Pathway
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107529039 (SSB)
SSDB
Motif
Pfam: RRM_3 La RRM_1
Other DBs
NCBI-GeneID: 107529039
NCBI-ProteinID: XP_016057845
LinkDB
Position
Unknown
AA seq 404 aa
MAENGDEKLAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRL
TTDFNVIVEALSKSKAELMEISEDKTKIRRSPNKPLPEVTDEYKNDVKNRSVYIKGFPTD
ATLDDIKEWLEGKGQVLNIQMRRTLHKAFKGSIFAVFDSIESAKKFVETPGQKYKDTDLL
ILFKEDYFAKKNEERKQNKVEAKLRAKKEQEEKQKLAENAEMKSLEEKIGCLLKFSGDLD
DQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALDKAKDANNGNLQLRNKEV
TWEVLDGDVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQTGSAKGKVQFQGKK
TKFDSDDERDENGASGPVKRAREETDKEEPASKQQKTENGAGDQ
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggccgaaaatggtgatgaaaaactggctgctctggaggccaaaatatgtcatcaaatt
gagtattattttggtgacttcaatttgccacgagacaaatttttaaaggaacaaatcaaa
ctggatgaaggctgggtacctttggaaataatgataaaattcaataggttaaatcgtcta
acaacagactttaatgtaatagtagaagcattgagcaaatcaaaggcagaactcatggaa
ataagcgaagataaaaccaaaatcagaagatctccaaacaaacctctacctgaagtgact
gatgaatataaaaatgatgtaaaaaacagatctgtttatattaaaggtttccctactgat
gcaacccttgatgacataaaagaatggttagaaggtaaaggtcaagtactaaatattcag
atgagaagaacattgcacaaagcatttaagggatccatatttgctgtgtttgatagcatt
gaatctgctaaaaagtttgtggagacccctggacaaaagtacaaagatacagatctgcta
atacttttcaaggaagattactttgcaaaaaaaaatgaagaaagaaagcaaaataaagtg
gaagctaaattacgagctaaaaaagaacaagaagaaaaacaaaagctagcagaaaatgct
gaaatgaaatctctagaagaaaagattggctgcttgttgaaattttcgggggacctagat
gatcagacctgtagagaagatttgcacattcttttctcaaatcatggtgaaataaaatgg
atagactttgtcagaggagcaaaagagggaataattctgtttaaagaaaaagctaaggaa
gcactggataaagccaaggatgcaaataatggtaatctacaattaaggaacaaagaagtg
acatgggaagtactagatggagatgtggaaaaagaagcattgaaaaaaatcatagaagat
cagcaagaatccttaaacaaatggaagtcaaaaggtcgcagatttaaaggaaaaggaaag
ggaaataaagctgcccagactgggtctgctaaaggaaaagtacagttccagggcaagaaa
actaaatttgatagtgatgatgaacgtgatgaaaatggtgcatcaggaccagtaaaaaga
gcaagagaagaaacagacaaagaagaacctgcatcaaaacagcagaaaacagaaaatggt
gctggagaccagtaa

DBGET integrated database retrieval system