KEGG   Miniopterus natalensis: 107529054
Entry
107529054         CDS       T05883                                 

Gene name
MPZL1
Definition
(RefSeq) myelin protein zero-like protein 1
  KO
K06770  myelin protein zero
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107529054 (MPZL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mna04515]
    107529054 (MPZL1)
Cell adhesion molecules [BR:mna04515]
 Immunoglobulin superfamily
  P0
   107529054 (MPZL1)
SSDB
Motif
Pfam: V-set ig Ig_3 Adeno_E3_CR2 I-set Syndecan
Other DBs
NCBI-GeneID: 107529054
NCBI-ProteinID: XP_016057822
LinkDB
Position
Unknown
AA seq 294 aa
MIEDKDLNESSRHHREPARNVLCAHGPTRDGVYSLGSRAGQAAAVTVPDRCFSLEVTAGV
SALEVYTPKEIYVANGTQGKLTCTFKSANTTGRLTTISWSFQPEGTHTTVSFFHYSQGQV
YIGDYPPFKDRIRWAGDLDKKDASINIENIQFIHNGTYICDVKNPPDIVVHPGHIRLYVV
EKEVLPMFPVWVVVGIVTAVVVGLTLLVSMILAVLYRRKHLKRDYTGCSTSESVSPVKQA
PRKPPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
NT seq 885 nt   +upstreamnt  +downstreamnt
atgatcgaggacaaagacctgaacgaaagcagccggcatcatcgtgagccagctagaaat
gtcctgtgtgcacacggacccacgcgagacggagtttactccctgggctccagggcaggt
caggctgctgcagtaacagtacctgacagatgcttctccctcgaagtgactgctggtgta
tcggccttggaggtatacaccccaaaagaaatctacgtggcaaatgggacacaagggaag
ctgacgtgcacattcaagtctgcgaacaccaccggcaggttgaccacaatctcctggagc
ttccagccagaggggacccacaccactgtgtcgtttttccactactcccaagggcaagtg
tacattggggattacccaccatttaaggacagaatccgctgggccggtgaccttgacaag
aaggacgcatcgatcaacatagaaaacatacagtttatccacaacggcacctacatctgt
gatgtcaagaaccctcctgacatcgttgtccacccgggacacattcgactctatgttgta
gagaaagaggttttgcccatgtttccggtttgggtggtggtgggtatagtgactgctgtg
gtcgtggggctcaccctgctcgtcagcatgatcctggctgtcctctacagaaggaaacac
ttgaaacgggattacacgggctgcagcacctcagagagtgtgtcgccggttaagcaggct
ccgcggaagcccccctccgacacagagggtctagtaaagagcctgccttctggatctcac
cagggcccagtcatatatgcgcagctagaccactctggaggacaccacagtgacaagatt
aacaagtcagagtctgtggtatatgcggacatccggaaaaattaa

KEGG   Miniopterus natalensis: 107535130
Entry
107535130         CDS       T05883                                 

Gene name
MPZ
Definition
(RefSeq) LOW QUALITY PROTEIN: myelin protein P0
  KO
K06770  myelin protein zero
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107535130 (MPZ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mna04515]
    107535130 (MPZ)
Cell adhesion molecules [BR:mna04515]
 Immunoglobulin superfamily
  P0
   107535130 (MPZ)
SSDB
Motif
Pfam: Myelin-PO_C V-set Ig_2 Ig_3 ig I-set Tweety Amnionless LST1 Smim3
Other DBs
NCBI-GeneID: 107535130
NCBI-ProteinID: XP_016065957
LinkDB
Position
Unknown
AA seq 312 aa
MAPGAAWSSPGPILTALLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSD
DISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYS
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGAILGGVLLLLLLFYLIR
YCWLRRQATLQRRLSAMEKGKLHKSGKDTSKRGRQTPVLYAMLDHSRSTKAASEKKSKGL
GESRKDKKXRLAGRAGARGSGAESSKGAQVVVIEMELRKDEQSSELRPAVKSPSRTSLKN
ALKNMMGLDLDK
NT seq 939 nt   +upstreamnt  +downstreamnt
atggctcctggggctgcctggtccagccccggtcctatcctgactgcgctgctcttctcc
tctttggtgctgtccccagcccaggccattgtggtttacacggacagggaggtacatggt
gctgtgggctcccgagtgaccctgcactgctccttctggtccagtgagtgggtctcagat
gacatctccttcacctggcgctaccagcctgaagggggccgcgatgccatctcgatcttc
cactatgccaagggacagccatacatcgacgaggtggggaccttcaaagagcgcatccag
tgggtaggggaccctcgctggaaggatggctccattgtcatacacaacctggactatagt
gacaacggcactttcacctgtgatgtcaaaaatccaccagacatagtgggaaagacctct
caggtcacactctatgtctttgaaaaagtaccgactcgctatggggtggtgctgggtgcc
gtcatcggggccatcctgggcggcgtgctcttgctgctgctgctcttctacctgatccgg
tactgctggctacgcaggcaggcgaccctgcagaggaggctcagtgccatggagaagggg
aaactgcacaagtctgggaaggacacgtccaagcgtggccggcagacgccggtgctgtat
gccatgctggaccacagcagaagcaccaaagctgccagtgagaagaagtccaaggggctg
ggggagtctcgcaaggataagaaatagcggttagcgggccgggcgggggctcgggggtca
ggggcggagtcctccaaaggcgctcaggtggtggtcatcgagatggagcttcgaaaggat
gagcagagctcggagctcaggcctgctgtcaagtcccccagcagaaccagcctcaagaat
gccctcaagaacatgatgggcctggacttggacaagtga

DBGET integrated database retrieval system