KEGG   Miniopterus natalensis (Natal long-fingered bat): 107529121
Entry
107529121         CDS       T05883                                 
Symbol
SSR1
Name
(RefSeq) translocon-associated protein subunit alpha
  KO
K13249  translocon-associated protein subunit alpha
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107529121 (SSR1)
SSDB
Motif
Pfam: TRAP_alpha DNA_pol_phi
Other DBs
NCBI-GeneID: 107529121
NCBI-ProteinID: XP_016057908
LinkDB
Position
Unknown
AA seq 286 aa
MRLLPRLLLLLLLVFPATLLLRGGRGGSVAAAQDLTEDEEAVEDSVIEDEDDEAEVEEDE
PTDLAEDKEEEDVSSEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESL
DASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDL
NGNVFQDAVFNQTVTIIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLLESRKRKRPVQK
VEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
NT seq 861 nt   +upstreamnt  +downstreamnt
atgaggctcctcccccgcctgcttctgcttctcttgctcgtgttccccgccaccctcttg
ctccgaggcggccgtggaggctcagtagcagcagctcaagatcttacagaagatgaagaa
gcagtggaagattcagtaattgaagatgaagatgatgaagcagaggttgaagaggatgaa
cccacagacttggcagaagataaagaggaagaagatgtatctagtgaacctgaagcttca
ccaagtgcagatacaactatcctgtttgtgaaaggagaagattttccagcaaataacatt
gtgaaattcctggtaggctttacaaacaagggtacagaagattttattgttgaatcccta
gatgcctcattccgttatcctcaggactaccagttttatatccagaatttcacagctctt
cctctgaacactgtagtgccaccccagagacaggcaacttttgagtactccttcattcct
gcagagcccatgggtggacgaccctttggtctagtcatcaatctgaactacaaagatttg
aacggcaatgtatttcaagatgctgtcttcaatcaaacagttacaattattgaaagagag
gatgggctagatggagaaacaatctttatgtatatgtttcttgctggtcttgggctcttg
gttgttgttggccttcatcaactcctggaatctagaaagcgcaagagacccgtacagaaa
gtagagatgggtacatcaagtcagaatgatgttgacatgagctggattcctcaggaaact
ttgaatcaaatcaataaagcttcaccaagaaggttgcccaggaagcgggcacagaagaga
tcagtgggatctgatgagtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107538804
Entry
107538804         CDS       T05883                                 
Symbol
SSR4
Name
(RefSeq) translocon-associated protein subunit delta isoform X1
  KO
K04571  translocon-associated protein subunit delta
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107538804 (SSR4)
SSDB
Motif
Pfam: TRAP-delta
Other DBs
NCBI-GeneID: 107538804
NCBI-ProteinID: XP_016070618
LinkDB
Position
Unknown
AA seq 173 aa
MVALASLGALALLLLSGLSCCSAEACVEPQITPSYYTTSDAVISTETVFIVEISLTCKNR
VQNMALYADVSGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQR
NNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAVIGIVIYYLAFNAKSHIQA
NT seq 522 nt   +upstreamnt  +downstreamnt
atggtggcgctggcatctctcggcgcattggcgctactcctgctgtctggcctctcctgc
tgctcagcagaggcctgtgtggagccccagatcaccccttcctactatacaacctctgat
gccgtcatttccactgagactgtcttcatcgtggagatttccctgacatgcaaaaacagg
gttcagaacatggctctttatgctgatgtcagtggaaaacaatttcctgtcacccgtggc
caggacgtagggcgttatcaggtgtcctggagcctagatcacaagagtgctcatgctggg
acctatgaggtcaggttcttcgacgaggagtcctacagcctcctgaggaaggctcagaga
aataacgaggacatttccatcatcccacccctgttcacagtcagcgtagaccatcggggc
acctggaacgggccctgggtttccactgaggtgttagccgcagtcattggcatagtgatc
tactacctggccttcaacgccaagagccacatccaggcctga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107544692
Entry
107544692         CDS       T05883                                 
Symbol
SSR3
Name
(RefSeq) translocon-associated protein subunit gamma
  KO
K13251  translocon-associated protein subunit gamma
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107544692 (SSR3)
SSDB
Motif
Pfam: TRAP-gamma Renin_r
Other DBs
NCBI-GeneID: 107544692
NCBI-ProteinID: XP_016078089
LinkDB
Position
Unknown
AA seq 185 aa
MAPKGGSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV
LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER
ILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALL
STGSK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggctcccaaaggcggctccaagcagcagtccgaagaggacctgctcctgcaggacttc
agtcgcaacctctcggccaagtcctccgcgctcttctttgggaacgccttcatcgtgtcc
gccatccccatctggttatactggcgaatatggcacatggatcttattcagtctgctgtt
ctgtacagcgtgatgaccctagtaagcacttatttggtagcctttgcttacaaaaatgtg
aaatttgttctcaagcacaaagtagcacagaagagggaagatgctgtttccaaagaagtg
acacggaaactttctgaagctgataatagaaagatgtctcggaaggagaaagatgaaaga
atcttgtggaagaagaatgaagttgctgattacgaagccacaacattttccatcttctat
aacaacaccctgttcctggtcctggtcattgttgcatctttctttatattgaagaacttc
aaccccacagtaaactatattctctccataagtgcttcatcaggtctcatcgcccttctg
tctactggctccaagtag

DBGET integrated database retrieval system