KEGG   Miniopterus natalensis (Natal long-fingered bat): 107529152
Entry
107529152         CDS       T05883                                 
Symbol
EDEM1
Name
(RefSeq) ER degradation-enhancing alpha-mannosidase-like protein 1 isoform X1
  KO
K10084  ER degradation enhancer, mannosidase alpha-like 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107529152 (EDEM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107529152 (EDEM1)
Lectins [BR:mna04091]
 M-type lectins
  107529152 (EDEM1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 107529152
NCBI-ProteinID: XP_016057948
LinkDB
Position
Unknown
AA seq 481 aa
MCPDRDSNPDRLAPRPRLTCWATPAGLLCLSERDCTHLTANVILFSCVPPVTRVLGSLLS
AHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPD
SNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSDGTGLLGNVVNIQTG
HWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLDMFNAAYRSIQSHLRRGREACNEGEGD
PPLYVNVDMFSGRLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY
NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKAKCGYATLHH
VIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSVDKHLRESPWK
EFFPEEGPRDVEGKSVQRPKSHDLKVINSSSNCNRVPDERRYSLPLKSVYMRQIDQMVGL
V
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtgccccgaccgggactcgaaccccgatcgcctggcccctaggccgaggctcacctgc
tgggccacgccggccgggctgctctgcctgtctgaacgggactgtacacatctcacagcc
aacgtgattctgttttcctgtgttcctcctgtcactagggtcctgggaagcctcctttct
gcccacagaataataacagactccaagcagccctttggggacatgacgattaaggactat
gacaacgagctgctgcacatggcccacgacctggccgtgaggctcctccctgcctttgag
aacaccaagacggggattccctacccgcgggtgaacctgaagacgggcgttccccccgac
agcaacaacgagacgtgcacggctggggctggctccctcctggtggagtttgggatcctg
agccgcctgctgggggactccacgtttgagtgggtggccaggcgggcggtgaaagccctc
tggaacctccggagcgacggcacggggctgctgggcaacgtggtcaacattcagacgggc
cattgggttgggaagcagagcggcctgggggccgggctggactccttctatgagtacctc
ctgaagtcctacattctctttggagagaaggaagacctggacatgttcaacgccgcctac
cgcagcatccagagccacctgcgcagaggccgggaagcctgcaacgagggcgaaggggac
cccccgctctacgtcaacgtggacatgttcagcgggcggctgatgaacacgtggatcgac
tccctgcaggctttcttccccgggctgcaggtgctgataggagacgtggaggacgccatc
tgcctgcacgccttctactacgccatctggaagcggtacggggccctcccggagcggtac
aactggcagctgcaggcccccgacgtgctcttctacccgctgcggccggagctggtggag
tccacgtacctgctctaccaggccaccaagaaccccttctacctccacgtgggaatggac
atcctgcagagcctggagaagtacacgaaagccaagtgcgggtacgccacactgcaccac
gtcatcgacaagtccaaggaggaccggatggagagcttcttcctcagcgagacctgcaag
tacttgtacctgctgtttgatgaggagaatccagtacacaaatccggaaccagatacatg
tttacaactgagggacacattgtgtctgtggacaagcaccttcgggagtcgccctggaag
gagttctttccggaagagggaccaagggacgtggaggggaagtctgtgcagaggcccaag
tctcacgacctgaaagtcatcaactccagctccaactgcaaccgagtccctgacgagcgg
agatactcgctgcccctgaagagcgtctacatgagacagatcgaccagatggtcggcctc
gtctga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107537205
Entry
107537205         CDS       T05883                                 
Symbol
EDEM2
Name
(RefSeq) ER degradation-enhancing alpha-mannosidase-like protein 2 isoform X1
  KO
K10085  ER degradation enhancer, mannosidase alpha-like 2
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107537205 (EDEM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107537205 (EDEM2)
Lectins [BR:mna04091]
 M-type lectins
  107537205 (EDEM2)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 107537205
NCBI-ProteinID: XP_016068664
LinkDB
Position
Unknown
AA seq 576 aa
MPFRLLLPLGLLCLLLPPHQGAPGPDGTAPDPAHYRERVKAMFYHAYDSYLENAFPYDEL
RPLTCDGHDTWGSFSLTLIDALDTLLILGNVSEFQRVVEVLQDNLDFDIDVNASVFETNI
RVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLH
GVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHID
VLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDTKLMAMFLEYNKAIRNYTRFDDWYLWV
QMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYT
VEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHK
LDNRMESFFLAETVKYLYLLFDPSNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPI
DPAALHCCRRLKEEQWEVEDLMREFYSLKRNRSRFQKTISSGPWEPPARPGTFSSPGTHD
EAREKPARRRVPLLSCPSQPFTSKLALLGQVFLDSS
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgcctttccggctgctgctcccgctcggcctcctgtgcttgctgctgccaccgcaccag
ggcgcgccgggcccggatggcaccgcgcccgaccccgcccactacagggagcgcgtcaag
gccatgttctaccacgcctacgacagctacctggagaatgcgtttccctacgacgagctg
cgacccctcacctgcgatgggcacgacacctggggcagcttttctctgactctaattgat
gctctggacaccttgctgattttggggaatgtctcagaattccaaagggtggttgaagtg
ctccaggacaacttggactttgacattgatgtgaatgcctctgtgtttgaaaccaacata
cgagtggtaggaggacttctgtctgctcacctgctatcgaagaaggctggggtggaagta
gaagccggatggccctgttctggacctctcctgaggatggctgaagaggcggcccgaaag
ctcctcccagcctttcagacccccaccggcatgccatatggaactgtgaacctgcttcat
ggtgtgaacccgggagagacccctgttacctgtacggcagggattgggaccttcattgtg
gaattcgccaccctaagcagcctcactggtgaccctgtgtttgaagacgtggccagagtg
gccctgatgcgtctctgggagagccggtcagatattgggctggttggcaaccacattgat
gtgctcactggcaagtgggtggcccaggacgcgggcatcggggctggtgtggactcctac
tttgagtacctggtgaaaggagccatcctgcttcaggatacaaagctcatggctatgttc
ctagaatacaacaaagccattcggaattacacccgctttgatgactggtacctgtgggtg
cagatgtacaaggggactgtgtccatgccggtcttccagtccttggaagcctactggcct
ggtctgcagagcctcattggggacattgacaatgccatgaggaccttccttaactactac
actgtatggaagcagtttggggggctcccggaattctacaacattcctcagggatacacg
gtggagaaacgagagggttacccacttcggccggaactcattgagagcgccatgtacctc
taccgtgctacgggggatcccaccctcctagaacttgggagagatgctgtggagtccatt
gaaaaaatcagcaaggtggagtgtggatttgcaacgatcaaagacctgcgtgaccacaag
cttgacaaccgcatggagtctttcttcctggctgagactgtgaaatacctctacctcctg
tttgacccatccaacttcattcacaacaatggttccaccttcgatgcagtgatcaccccc
tacggggagtgcatcttgggggctgggggctacatcttcaacacagaagcgcaccccatt
gaccccgccgccctgcactgttgccggaggctgaaggaagagcagtgggaggtagaggac
ttgatgagggaattctactctcttaaacggaataggtcaagatttcagaaaactataagc
tcagggccatgggaacccccagcaaggccagggacattctcctcaccagggacccacgac
gaggcgagggagaagcctgccaggcggagagtcccgcttctcagctgccctagtcagccc
tttacctcgaagctggcgttactgggacaggttttcctggattcctcgtaa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107546284
Entry
107546284         CDS       T05883                                 
Symbol
EDEM3
Name
(RefSeq) ER degradation-enhancing alpha-mannosidase-like protein 3 isoform X1
  KO
K10086  ER degradation enhancer, mannosidase alpha-like 3
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107546284 (EDEM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107546284 (EDEM3)
Lectins [BR:mna04091]
 M-type lectins
  107546284 (EDEM3)
SSDB
Motif
Pfam: Glyco_hydro_47 PA Glyco_hydro_127
Other DBs
NCBI-GeneID: 107546284
NCBI-ProteinID: XP_016080134
LinkDB
Position
Unknown
AA seq 934 aa
MSEAGGGRGCGSPVPQRAPWSLVATTAALCLVTATSVWTAGAAPMSREERQKLGNQVLEM
FDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNK
TKEFEDAVRKVLTDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDEL
LQMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAAL
SRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYL
LKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQ
VLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGD
PYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKED
IIFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYVELDDSNFDWTCPNTQILFPNDP
LYAQSIREPLKNVVDKSCPRGIIRVREESFRSGAKPPLRARDFMATNPEHLEILKKMGVS
LIHLKDGRVQLVQHAIQAASSVDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIVSHPFF
GRVVLTAGPAQFGLDLSKHKETRGFVASSKPYNGCSELTNPEAVMGKIALIQRGQCMFAE
KARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSKEGSIILDA
IREYEEVEVLLSDKAKDRDPEMENEEQPFSENDSQYQSAEQLAPGSQEVDLVDGESPEEN
SPNSHPEPLSPAATDNAAGASPSEQNSDPTENQGPAGLDGECTDLDNQVQEQSETEEDSS
PNVSWGKKAQPIDSILADWNEDIEAFEMMEKGEL
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgagcgaagccggaggcggtcggggctgtgggtccccggtcccccagcgagcgccatgg
agcctggtggcgacgacggccgcgctctgcctggtgacggccacgtccgtgtggacggcg
ggggccgcacccatgagccgggaggagaggcagaagcttgggaatcaagtactggaaatg
tttgatcatgcttatggtaactacatggaacatgcttacccagctgatgaactcatgcct
ttaacctgcagaggccgtgttagaggccaggagccaagtcggggtgatgttgacgatgcc
ttgggaaaattttccctgacactgattgattctttggacactcttgtggtattaaataaa
actaaagaatttgaagatgcagtgagaaaagttttaacagatgttaatttagataatgat
gtagttgtatcagtctttgaaacaaacatcagagttcttgggggtcttttgggtggacac
tcattggcaatcatgctgaaagaaaagggggagtacatgcagtggtacaatgatgaactt
ctgcaaatggcaaagcaattgggttacaaacttttaccagctttcaatactaccagtggc
cttccttatccaagaattaatttaaagtttggtatcagaaaaccagaagctcggacagga
acggagaccgatacctgtacagcgtgtgcaggtaccttgatccttgagtttgccgcttta
agtcgattcacaggagcaacaatatttgaggaatatgcaagaaaagctcttgattttctc
tgggaaaaaagacagcgaagtagtaatttagtgggcgtgactataaatatccatacagga
gattgggtgcgaaaagatagtggagttggagcaggcattgattcctattatgaatatcta
ttgaaagcctatgtcttgcttggagatgacagttttctggaaagatttaatacacactat
gatgccataatgcggtacatcagccagccccctcttctactcgatgtgcacatccacaag
ccaatgctgaacgctcggacgtggatggatgctttgcttgccttttttccaggtctgcag
gtcttaaaaggggatattagacctgctattgaaactcatgaaatgttatatcaagtgatt
aaaaaacacaattttctaccagaggcatttaccacagattttagagtacattgggctcaa
caccctttaagaccagaatttgcagaaagtacctacttcttgtataaagctacaggagac
ccttactaccttgaagtagggaaaacacttattgaaaatttaaataaatatgctagagtg
ccttgtggatttgctgccatgaaggatgttcgtactggaagtcatgaagacagaatggat
tctttcttcttggctgaaatgtttaaatatctttacctgttatttgcggataaagaagat
attatttttgacatagaagattacatattcacaacagaagctcatttgttacctctgtgg
ctctctaccacaaatcaaagcatctctaagaagaacacaacttcagaatatgtagaactg
gatgacagtaattttgattggacttgtccaaatactcagattctcttccctaatgatcca
ctgtatgctcagagcattcgtgaacccttgaaaaatgtggtggataagagctgtcctaga
ggcatcatcagagtcagagaggagagtttcaggagtggagctaaaccccctctgagagcc
agagatttcatggccactaaccctgagcatttagaaatcttgaagaagatgggggtgagt
ttgattcacctcaaagatgggagagtccagttggttcaacatgcaatccaagctgctagt
tcagttgacgctgaagatgggctgaggttcatgcaggagatgattgaattgtcaagtcag
caacaaaaagaacagcagctacctccacgagcggtacagattgtttcacacccatttttt
ggcagggtagtattgaccgctgggccagctcagtttgggctagatctgtctaaacataaa
gagacacgaggatttgttgcaagcagtaaaccatacaatggttgttcagagcttacgaac
cccgaggcagtaatgggaaaaattgctttgatacaaagaggacagtgcatgtttgcagaa
aaggcacgcaacatccagaatgctggggccattggcggcattgttattgatgacaatgag
gggagcagcagtgatactgcccctctgttccagatggcaggtgatgggaaggacacagat
gacatcaagatccccatgctgttcttgttcagtaaagaaggaagtatcatattggatgct
atccgggaatatgaggaggtggaagtgctcctttctgacaaagcaaaagatcgagatcct
gaaatggaaaatgaagaacagccattctctgaaaatgattctcagtaccagagtgccgag
cagctcgccccaggttctcaggaggtggatttggtggatggagagtctcctgaagagaac
tctccaaactctcacccagaaccattatctccagcagctacggacaatgctgcaggagct
tctccttctgaacagaattctgatcccacagaaaaccaggggcccgcaggccttgatggt
gaatgtacagatttagataaccaagttcaagaacaatcagaaactgaggaagattccagt
cccaacgtcagctggggtaaaaaggcccagcccatagactccatattagcagactggaat
gaagatatagaagcatttgaaatgatggagaaaggcgaactatga

DBGET integrated database retrieval system