KEGG   Miniopterus natalensis (Natal long-fingered bat): 107529255
Entry
107529255         CDS       T05883                                 
Symbol
MOGS
Name
(RefSeq) mannosyl-oligosaccharide glucosidase
  KO
K01228  mannosyl-oligosaccharide glucosidase [EC:3.2.1.106]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna00510  N-Glycan biosynthesis
mna01100  Metabolic pathways
mna04141  Protein processing in endoplasmic reticulum
Module
mna_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107529255 (MOGS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107529255 (MOGS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107529255 (MOGS)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.106  mannosyl-oligosaccharide glucosidase
     107529255 (MOGS)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107529255 (MOGS)
SSDB
Motif
Pfam: Glyco_hydro_63 Glyco_hydro_63N SSSPR-51
Other DBs
NCBI-GeneID: 107529255
NCBI-ProteinID: XP_016058042
LinkDB
Position
Unknown
AA seq 839 aa
MARGERRRRGPPVDGAQTAERAARGGPARRESRIRVARGTVGGAVLAIVVLPLALTLSGS
WLLAWHRARRAVTLHSAPPALPPNSSSAAVAPDLFWGTYRPHVYFGMKTRSPQPLLTGLM
WAQQGTTQGTPKLRHTCEQGDGVGPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQH
GGDWSWRVTVEPQALGTSALPLVSLFFYVVTDGKEVLVPEVGTKGQLKFINGHSSELGDF
RFTLLAPTSPGDTAPKYGSYNVFWSSNPGLPLLTEMVKSRLNSWFQHRPPGASPDRYLGL
PGSLKWEDRVPSGQGEGQGQFLIQQVTVKVPFSVELVFESGSAQAGGNQALGQLAGSLLT
QALEHHAEAFRERFEKTFQLQKKGLSPEEQALGQAALSGLLGGIGYFYGQGLVLPDMKDE
GSEQKMAPALFPPVPLFTAVPSRSFFPRGFLWDEGFHQLVVQRWDPRLTREALGHWLGLL
NADGWIGREQVLGNEARARVPPEFLVQRAAHANPPTLLLPIAHMLEGGDPADLAFLRRAF
PRLHAWFSWLHQSQAGPVPLSYRWRGRDPALPTLLNPKTLPSGLDDYPRASHPSATERHL
DLRCWVALGARVLVQLAEQLGEAEAAAELGPLAASLGAEEILDELHWAPELGIFADFGNH
TKAVQLKPRPPQGLVRVVGRPHPRLQYVDALGYVSLFPLLLQLLDPHSSRLGPLLDVLAD
GRHLWSPFGLRSLAASSPFYGQRNSEHDPPYWRGAVWLNINYLALGALHYYGHLEGPHQA
RAAKLHSELRANVVGNVLRQYQATGFLWEQYSDRDGRGMGCRPFQGWTSLVLLAMAEDY
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggctcggggcgagcggcggcgccgcggaccgccggtagatggagcgcagacggctgag
agagcggctcggggcggccccgcgcgaagggaaagccggatccgcgtggcccgtggcacg
gtcgggggagcagttctggccatcgtagtcctgcctctggccctcaccctgtcgggaagc
tggctactggcgtggcaccgtgcgcggcgggcagtcacgctgcactccgcgcccccggcg
ctgcctcccaactcttctagtgcagctgtggccccagacctcttctggggcacgtaccgc
ccacacgtctacttcggcatgaagactcgtagcccgcagcccctcctcacaggactgatg
tgggcacagcaaggcaccacccaagggacccctaagctcaggcatacctgtgagcagggg
gacggcgtgggtccctatggctgggagttccacgatggtctctccttcgggcggcaacac
atccaggatggggccttaaggctcaccactgaattcgtcaagagacctgggggtcaacac
ggaggggactggagctggagagtgactgtagagcctcaggccttaggtacctctgccctc
cctttggtgtccctattcttctatgtggtgacagatggcaaggaagtcctagtgccagag
gttgggactaaggggcagttgaagttcatcaatgggcactccagtgaacttggtgacttc
cgttttacacttttggcaccaaccagtccaggggatactgctcccaagtacggcagctac
aatgtcttctggtcctccaacccaggacttcccttgctgacagagatggtgaagagtcgc
ctaaatagctggtttcagcatcggcccccaggggcctcccctgaccgctatcttggcttg
ccaggatctctgaagtgggaagacagagtcccaagtgggcaaggagaaggacaagggcaa
ttcttgatacaacaggtgacagtgaaagtccccttttctgtggagctggtgtttgaatct
ggcagtgcccaggcaggaggaaaccaagccctggggcagctggcaggcagcttgctgacc
caagccctggagcaccatgccgaagcctttagagagcgctttgagaagactttccagtta
cagaagaagggcttgagccctgaggagcaagctttgggtcaggctgccctcagcggtctc
cttggtgggatcggctacttctatggacagggtcttgtgttgccagacatgaaggatgag
gggtccgagcagaagatggccccagccctctttccacctgtccctcttttcacagcagtg
ccctcccgatcgttcttcccaagaggcttcctttgggatgagggctttcaccagctagtg
gttcagcggtgggatccccgcctcacccgggaggccctaggtcactggctggggctactc
aatgctgatggctggattgggcgggagcaagtgctggggaatgaggcccgagcccgggta
cccccagaattcctggtgcaacgggcagcccacgccaaccccccaaccctgcttttgccc
atagcccacatgctagagggtggtgatcctgccgacttagccttcctccgcagggccttc
ccccgcctgcatgcatggttctcctggctccatcagagccaggcagggccagtaccacta
tcttaccgctggcggggtcgggacccagccttgccaaccctattgaaccccaagacactg
ccttcagggctggatgactatccccgtgcttcacacccttcagccactgaacggcacctg
gacctacggtgctgggtggcactgggtgcccgtgtactggtacagctagcagagcagctg
ggagaggctgaggcagctgcggagctgggcccactggctgcctcactgggggcagaggaa
atcctagatgagctacactgggccccagagctaggaatctttgcagactttgggaaccac
acaaaagcagtgcagctgaagcctcggccccctcaggggctggtgcgggtggtgggccgg
ccccaccctcgcttgcaatatgtggatgccttgggctatgtcagtctttttcccttgctg
ctgcagctgctggacccccactcatcccgccttggaccactgctggatgttctagctgac
ggtcgacatctctggagcccctttggtttgcgctcccttgcagcctccagccccttttat
ggccagcgcaattcagagcatgatcctccctactggcgaggtgctgtgtggctcaatatc
aactacctggccttaggggctctccactactatgggcatttagagggtccccaccaagcc
cgcgctgccaagctccacagtgagctccgtgccaatgtggtgggcaatgtgttgcggcag
tatcaggccacaggtttcctgtgggagcagtacagtgaccgggatgggcggggcatgggc
tgccgccctttccaaggttggaccagccttgtcctactagcaatggctgaagactactaa

DBGET integrated database retrieval system