KEGG   Miniopterus natalensis (Natal long-fingered bat): 107529544
Entry
107529544         CDS       T05883                                 
Symbol
SEC62
Name
(RefSeq) translocation protein SEC62 isoform X1
  KO
K12275  translocation protein SEC62
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna03060  Protein export
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    107529544 (SEC62)
   04141 Protein processing in endoplasmic reticulum
    107529544 (SEC62)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mna02044]
    107529544 (SEC62)
Secretion system [BR:mna02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   107529544 (SEC62)
SSDB
Motif
Pfam: Sec62 DEP
Other DBs
NCBI-GeneID: 107529544
NCBI-ProteinID: XP_016058493
LinkDB
Position
Unknown
AA seq 439 aa
MGAIWAFHPCDFPPCRSCCLPRGLNTWHILDSGCSSSQLMCLETFMCHHKSIEVGEPSKE
EKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVD
YCNRLLKKQFFHRALKVMKMKYDKDIKKEKEKGKAESGKEEDKKSKKESLKDEKTKKEKE
KKKDGEKEESKKEEPPGTPKKKETKKKFKLEPHDDQVFLDGNEVFVWIYDPVHFKTFVMG
LILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRH
HFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKRQQKSDSEEKSDSERKED
EEGKVGPASHGAEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCE
EEEEDDDDGETTKSSHEKS
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgggagccatctgggcatttcatccctgcgattttcccccctgtcgttcttgctgttta
ccaaggggattaaatacatggcacatcttagactcaggatgttcctcgtctcagctaatg
tgcctggaaaccttcatgtgtcatcataaatcgatagaagttggtgaaccatctaaagaa
gagaaggctgtagccaagtatcttcgattcaactgtccaacaaagtctaccaatatgatg
ggtcaccgggttgattattttattgcttcaaaagcagtggactgccttttggattcaaag
tgggcaaaggccaagaaaggagaggaagctttatttacaacaagggagtctgtggttgac
tactgcaacaggcttttaaagaaacagttttttcaccgagcactaaaagtaatgaaaatg
aagtatgataaagacataaaaaaagaaaaagaaaaaggaaaagctgaaagtgggaaagaa
gaagataaaaagagcaagaaagaaagtctaaaggatgaaaagaccaaaaaggaaaaagaa
aaaaaaaaagacggagaaaaggaagaatcaaaaaaggaggaacctccaggaactcccaaa
aagaaggaaactaagaaaaaattcaagcttgagccacatgatgatcaagtttttctggat
ggaaatgaggtatttgtgtggatctatgacccagttcactttaaaacctttgtcatggga
ttaattcttgtgattgcagtgatagcagccacccttttccctctttggccagcagaaatg
agagtgggtgtttattacctcagtgtgggtgcaggctgttttgtagccagcattcttctc
cttgctgttgctcgttgcattctgtttctcatcatttggctcataactggaggaaggcac
cacttctggttcttgccaaatctgactgccgatgtgggcttcattgactccttcaggcct
ctgtacacacatgaatataaaggaccaaaggcagacttaaagaaagatgagaagtctgaa
accaaaaggcagcagaagtccgacagtgaggaaaagtcagacagtgagagaaaggaagat
gaggagggtaaagtaggacccgcaagtcacggagcagaaggctcgggtggagaacggcat
tctgatacggacagtgacaggagggaggatgaccgatcccagcacagtagtgggaatggg
aatgattttgaaatgatcacaaaagaggaactggaacaacaaacagatggtgattgtgaa
gaggaggaagaagatgacgatgatggagaaacaactaaatcttcacatgaaaaatcataa

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107540708
Entry
107540708         CDS       T05883                                 
Symbol
SEC63
Name
(RefSeq) translocation protein SEC63 homolog
  KO
K09540  translocation protein SEC63
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna03060  Protein export
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    107540708 (SEC63)
   04141 Protein processing in endoplasmic reticulum
    107540708 (SEC63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107540708 (SEC63)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mna02044]
    107540708 (SEC63)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP40 / DNAJ
   107540708 (SEC63)
Secretion system [BR:mna02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   107540708 (SEC63)
SSDB
Motif
Pfam: Sec63 DnaJ
Other DBs
NCBI-GeneID: 107540708
NCBI-ProteinID: XP_016073017
LinkDB
Position
Unknown
AA seq 704 aa
MWYRLRLLKPQPNIIPTIKKVVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGAT
VTEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFG
IALPAWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVY
KTRNMDMKRLIMVLAGASEFDPQYNKDATSRPTDNVLIPQLIREIGSINLKKNEPPLTCP
YSLKARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIIMARSREEREFR
APTLASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLK
ETDRHYLLHFLEDEKYEEVMAVLGSFPHVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTR
QTMAEVFEKEQSICAAEEQPTEDMQGDTNKNRTKGGWQQKSKGPKKTTKSKKKKTIKKKP
TPVPLSQSKQQKQKQANGVIGSEAAVKEEEEEVSDKGSDSEEEETNRDSQSEREDGSDRD
SDREHDEKQSKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIA
DRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEV
HEAKPVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEDDD
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgtggtatcgtttacggttattaaaaccccagccaaatattattcctacaataaagaaa
gtagttctgcttgcaggatgggcattattcttattccttgcatacaaagtttccaaaaca
gaccgagaatatcaagaatacaatccttatgaagtattaaatttggatcccggggcaaca
gtaacagaaattaagaaacagtatcgtttgctgtcacttaaatatcacccagataaagga
ggtgatgaagttatgttcatgaggatagcaaaagcttacgcagctttaactgatgaagag
tcccggaaaaattgggaagagtttggaaatccagatggacctcaagccacaagctttgga
atagccctgccagcttggatagttgaccagaaaaattcaattttggttttacttgtatat
ggattggcattcatggtcatccttccagttgttgtggggtcttggtggtatcgctcaata
cgctacagtggagaccagattctaatacgtacaacacagatttatacatattttgtttat
aaaacccgaaatatggatatgaaacgtcttatcatggttttggctggagcctctgaattt
gatcctcaatataataaagatgccacaagcagaccaacagataatgttctcatacctcag
ctgatcagagaaattggcagcattaatttaaagaagaatgaacctccacttacctgtcca
tatagcctgaaggccagagttcttttattgtctcaccttgctagaatgaaaattcctgag
acccttgaagaagatcagcagtttatgctgaaaaaatgccctgccctacttcaagaaatg
gttaatgtaatctgccaactaataataatggcccggagccgtgaagaaagggagtttcgt
gctccaactttggcatccctagaaaactgcatgaagctttctcagatggctgtgcaaggc
cttcagcaatttaagtctccccttctgcagctccctcacattgaagaggataatcttaga
agggtttctaatcataaaaagtacaaaattaagactattcaggatttggtgagtttaaaa
gaaacagatcgtcactatctgttgcacttccttgaagatgaaaaatatgaagaggttatg
gctgtccttgggagttttccacatgtgactatggacataaaatcacaggtattggatgat
gaagacagcaacaacatcacagtaggatccctagttacagtgttggttaaattgacacgg
caaacaatggcagaagtatttgaaaaggagcagtctatctgtgctgcagaggaacagccc
acagaagatatgcaaggggacactaacaagaacaggacaaaaggaggatggcaacagaag
agtaaaggacctaagaaaaccactaaatcaaaaaaaaagaaaactattaaaaaaaagcct
acacctgtgcccttatcacaatcaaagcaacagaaacaaaagcaagcaaatggagtcatt
gggagtgaagctgcagtgaaggaagaggaagaagaggtgtctgataaaggcagtgactct
gaagaagaagaaaccaatagagactcgcagagtgagagagaggacggcagcgacagggac
tccgacagggagcacgatgagaagcagagcaaagatgacgaggcagagtggcaagaatta
caacaaagtatacagagaaaggagagagctttgctggaaaccaaatcaaagataacacat
cctgtttatagtctttactttcccgaggaaaaacaagaatggtggtggctttatatcgca
gataggaaagagcagacattaatatctatgccatatcatgtgtgtacactaaaagataca
gaagaggtagaattgaagtttcctgcgccaggcaagcctggaaattaccagtatacagtg
tttttgagatcagactcctatatgggtttggatcagataaagcctttgaagttggaagtt
catgaggctaagcctgtgccagaaaatcacccacagtgggatacagcaatagagggagac
gaagaccaggaggacagcgagggctttgaagacagcttcgaggaagaggaggaggaggag
gaagatgacgactga

DBGET integrated database retrieval system