KEGG   Miniopterus natalensis: 107529566
Entry
107529566         CDS       T05883                                 

Gene name
MYL2
Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
mna  Miniopterus natalensis
Pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04510  Focal adhesion
mna04530  Tight junction
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna05132  Salmonella infection
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107529566 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107529566 (MYL2)
   04530 Tight junction
    107529566 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107529566 (MYL2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107529566 (MYL2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107529566 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    107529566 (MYL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107529566 (MYL2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107529566 (MYL2)
   05414 Dilated cardiomyopathy
    107529566 (MYL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107529566 (MYL2)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107529566 (MYL2)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 107529566
NCBI-ProteinID: XP_016058516
LinkDB
Position
Unknown
AA seq 195 aa
MGLSAFKDQIAPKKAKKRAEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRD
TFAALGRVNVKNEEIDDMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGK
GVLKADYIKEMLTTQAERFSNEEVTGPFGCSLHPSSWHHPSGDSHLFSKTLLTPQRERTY
SLLSPYLTAIRSMPP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgggattgagcgcttttaaggatcaaattgcacccaagaaagccaagaagagagcagag
ggcgccaattccaacgtgttctccatgtttgaacagacccagatccaggaatttaaggag
gccttcaccatcatggaccagaacagggatggcttcatcgacaagaatgatctgagggac
acctttgctgctcttgggcgtgtgaacgtgaaaaatgaagaaatcgacgacatgatcaag
gaagccccgggtcccatcaacttcaccgtgttcctcaccatgtttggggagaaactgaag
ggggcggaccccgaggagaccattctcaacgcgttcaaagtgttcgaccccgaaggcaaa
ggggtgctgaaggctgattacattaaggagatgctgaccacgcaggcggagcgattttcc
aacgaggaggtaacagggccctttggatgctccctgcaccccagctcctggcatcaccct
tctggggactcgcatctcttttctaagacactcctgaccccacagcgagagaggacctat
tctttactgagcccgtatctcactgccatccgctcaatgcccccgtga

DBGET integrated database retrieval system