KEGG   Miniopterus natalensis: 107530026
Entry
107530026         CDS       T05883                                 

Gene name
PDCD1
Definition
(RefSeq) programmed cell death protein 1
  KO
K06744  programmed cell death protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04660  T cell receptor signaling pathway
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107530026 (PDCD1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107530026 (PDCD1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107530026 (PDCD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107530026 (PDCD1)
CD molecules [BR:mna04090]
 Proteins
  107530026 (PDCD1)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Ig_2
Other DBs
NCBI-GeneID: 107530026
NCBI-ProteinID: XP_016059107
LinkDB
Position
Unknown
AA seq 290 aa
MGTPWAPWPLIWAVLQLGWWPGWLLETPDKPWSSLTFNPPQLTVAEGETATFTCSFSNTS
ERFVLNWYRMSPSNQTDKLAAFPEDSKQAHRDQRFHVTRLPNGRDFEMSVLTTQRNDSGI
YLCGAIYLPPETQIHESPHAELTVTERVLELPTKSPSPLPRPVGHLQGLVIGVTSVLVGV
LLLLLLTWVLATRGNAPATGTLGLEARSENQPLKEGPSPGPVFSVDYGELDFQWREKTPE
PPAPCVPEQTEYATIVFPGKPGSPSRRASANSPQGPWPVRHEDGHCSWPL
NT seq 873 nt   +upstreamnt  +downstreamnt
atggggaccccgtgggctccatggccactcatctgggcagtgctgcagctgggctggtgg
ccaggatggctcctagaaacccccgacaagccctggagttctctcaccttcaacccgccc
cagctcactgtggctgaaggggagactgccaccttcacctgcagcttctccaacacgtct
gaacgcttcgtgctcaactggtaccgtatgagccccagcaaccagacagacaagctggct
gccttccctgaggacagcaagcaggcccacagggaccagcgcttccacgtaactcggctc
cccaacgggcgggacttcgaaatgagtgtcctcaccacccagcgcaacgacagtggcatc
tacctctgtggggccatctacctgccccccgagacacagatccacgagagcccccacgca
gagctcacggtgacagagagagtcctggaactgcccactaagagccccagccccctgccc
aggccggtaggtcacctacagggcctggtcatcggtgtcacaagtgtcctggtgggcgtc
ctgctgcttctgctgctgacctgggtcctggccactcgaggtaatgccccagccacagga
accctaggcctggaagccaggagtgagaaccagcctctgaaggagggcccctccccaggg
cctgttttctccgtggactatggggagctggacttccagtggcgggagaagaccccggag
ccccctgccccttgtgtcccggaacagacggagtacgccaccattgtcttccctggaaaa
ccaggctcccccagccgcagggcctctgccaacagcccacaggggccctggcctgtgaga
cacgaggatggacactgctcttggcccctctga

DBGET integrated database retrieval system