KEGG   Miniopterus natalensis (Natal long-fingered bat): 107530132
Entry
107530132         CDS       T05883                                 
Symbol
SIL1
Name
(RefSeq) nucleotide exchange factor SIL1
  KO
K14001  nucleotide exchange factor SIL1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107530132 (SIL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mna03029]
    107530132 (SIL1)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    107530132 (SIL1)
SSDB
Motif
Pfam: Fes1 DUF4704 V-ATPase_H_C
Other DBs
NCBI-GeneID: 107530132
NCBI-ProteinID: XP_016059277
LinkDB
Position
Unknown
AA seq 464 aa
MPLRGLPLSRMAPLGMLLGLLMASCFTFCFSHQNTEFALTNPEKSTTKETERKETTAEEE
LDPEILEVFHPSHEWQVLRPGQAVPGGSHVRLNLQTGAREVKLQDEDNFRNTLKGSKKGK
RLDINTNTYTSQDLKNALAKFKEGAQMESSKEDKARQAEVKRLFRPIEELKKDFAELNVV
IETDMQIMVRLINKFNSSSSSLEEKIAALFDLEYYVHQMDNAQDLLSFGGLQVVINGLNS
TEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATEQPLTAKKKVLFALCSLL
RHFPYAQKQFLKLGGLQVLRSLVQEKGTEVLAVRVVTLLYDLVTEKMFAEEEAELTRDMS
PEKLQQYRQVHLLPSLREQGWCEITAHLLALPEHDAREKVLQTLGALLVTCWDRYHQDSQ
LSRMLANLQAEYQVLAAQELQDGEDKGYFWELLGSINNLLKELR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgcctctccggggcctgcccttatctaggatggctcctctgggcatgttgcttggcttg
ctgatggcctcctgcttcactttctgcttcagtcatcagaacacagagtttgcactgacc
aatccagagaagagcacgacgaaagaaacagagagaaaggaaacaacagcagaggaggag
ctggaccccgagatcctggaggtgtttcacccgagccatgagtggcaggtccttcggcca
ggtcaagctgtccctgggggatcccatgtgcggctgaatctccagactggagcaagagaa
gtgaaacttcaagatgaagacaactttcgaaatactttgaaaggctcgaaaaaaggcaaa
aggctggacatcaacactaatacctatacatcccaggacctcaagaatgcactggcaaaa
ttcaaggaaggggcacagatggagagttcaaaggaagacaaggcaaggcaggctgaggtt
aaacgtctcttccgccccattgaggagctaaagaaggactttgcagagctgaatgttgtc
attgagactgacatgcagatcatggtacggctgattaacaagttcaacagttccagctcc
agcctggaagagaaaattgctgcgctctttgatcttgaatattatgtccatcagatggat
aatgcacaggacctgctttccttcggtggccttcaagtggtgatcaatgggctgaacagc
acagagcctctggtgaaggaatatgctgcgtttgtgctgggggctgccttttccagcaac
ccaaaggtccaggtggaggccatcgaggggggagccttgcagaagctgctagtcatcctg
gctacagagcagcctctcactgcgaagaagaaggtcctattcgcactgtgctccctactg
cgacacttcccctatgcccagaaacagttcctgaagctggggggcttgcaggtcctgagg
agcttggtacaggagaagggcacagaggtgctggccgtgcgtgtggtcaccctgctctac
gatctggtcactgagaagatgtttgccgaggaagaggccgagctgacccgggatatgtcc
ccagagaagctgcagcagtatcgccaggtgcatctcctgccaagcctgcgagaacaaggc
tggtgtgagatcactgcccatctgctggcactgcctgaacatgatgcccgtgaaaaggtg
ctgcagacactgggtgccctcctcgtcacctgctgggaccgctaccaccaggactcccaa
ctcagcaggatgctggccaatctacaggctgaataccaggtgctagctgcccaggagctc
caagatggagaggataagggatacttctgggaactgctgggttctatcaacaacttgcta
aaggagctgagatga

KEGG   Miniopterus natalensis (Natal long-fingered bat): 107533100
Entry
107533100         CDS       T05883                                 
Symbol
HYOU1
Name
(RefSeq) hypoxia up-regulated protein 1 isoform X1
  KO
K09486  hypoxia up-regulated 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107533100 (HYOU1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107533100 (HYOU1)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP110
   107533100 (HYOU1)
SSDB
Motif
Pfam: HSP70 MreB_Mbl AbiEi_3_N
Other DBs
NCBI-GeneID: 107533100
NCBI-ProteinID: XP_016063166
LinkDB
Position
Unknown
AA seq 1014 aa
MRLSPGHPVTSVVFLLPRGAMAATVRTQRRLAYWALMAVLLADLLALSDMLAVMSVDLGS
ESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFFGDSAASLAVKNPKATLRYFQQ
LLGKQEGNPHVALYRDRFPEHELGFDPQRHTVHFQISPQLQFSPEEVLGMVLNYSRSLAE
DFAEQPIKDAVITVPAFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDIN
TTAQNIMFYDMGSGSTVCTIVTYQTVKTKEAGMQPQLQIQGVGFDRTLGGLEMELRLREH
LAGLFNEQRKGQRVKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAK
VTRVEFEELCADLFERVPGPVQQALQSAKMNLDEIEQVILVGGATRVPKVQEVLLKAVGK
EELGKNINADEAAAMGAVYQAAALSKAFKVKPFIVRDAVMYPILVEFTREVEEEPGVRGL
KHNRRVLFSRMGPYPQRKVITFNRYSHDFSFHVNYGDLGFLGPEDLRVFGSQNLTTVKLK
GVGESFKKYPNYESKGIKAHFNLDESGVLSLDRVESVFETLVEDSPEEESTLTKLGNTIS
SLFGGGTTPDTKENGTNTVQEEEESLAEGSKDDPGEQAELREEGEAPVEDTSRPPSPEPK
GNIAPEGEKPVDKENGEKPEAQKPSDKGEAGPEGVPAAPEEDKKQKPSRKQRAVEEIGVE
LLVLDLPDLSESELARSAQKLQDLTVRDLEKQEREQAANSLEAFIFETQDKLYQPEYQEV
STEEQRQEISGRLSAASTWLEDEGFGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERL
SALDNLLNHSSMFLKGARLIPEMDQIFTEVEMTTLEKVINETWAWKNATMAEQAKLPTTE
KPVLLSKDIEAKMMALDREVQYLLNKAKFAKPRPRPKDKNETQAEPPLNASDQGEKIIHP
PGQTEDAKPLSEPEKEIRSEPADTEPLELEGPRAESEQEEQPPRQKPVLKNDEL
NT seq 3045 nt   +upstreamnt  +downstreamnt
atgaggttgtctccggggcatccagttacaagtgttgtttttctcctccccaggggtgca
atggcagccacggtcaggacgcagaggaggctagcctattgggccttgatggctgtgctc
ttggcagacctattggccctgagtgacatgctggcagtgatgtctgtggacctgggcagc
gagtccatgaaggtggccatcgtcaaacctggagtgcccatggaaattgtcttgaacaag
gaatcccggaggaaaaccccagtgactgtgaccctgaaagaaaatgaaagattctttgga
gacagtgcagcaagcctggccgtcaagaatcccaaggccacgctgcgttacttccagcag
ctcctggggaagcaggagggtaacccccatgtagccctttacagagaccgtttcccagag
cacgagttaggcttcgacccacagaggcacactgtgcacttccagatcagcccgcagctg
cagttctcacctgaggaggtactgggcatggttctcaattattcccgttccctggctgaa
gattttgcagaacagcccatcaaggatgcagtgatcactgtgccagcgttcttcaatcag
gctgagcgccgagctgtgctgcaggctgctcgcatggctggcctcaaagtgctacagctc
atcaatgacaacactgccactgccctcagctacggtgtcttccgtcggaaagatatcaat
actactgcccagaacatcatgttttatgacatgggttcaggcagcactgtatgcaccatc
gtgacctaccagacagtgaagacgaaggaggcggggatgcagccacaactacaaatccag
ggagtggggtttgaccgcactctgggggggctagaaatggaactccggctacgtgagcac
ctggctggacttttcaatgagcaacgcaagggccagagagtgaaggatgtgagggagaac
cctcgtgccatggccaagctgctacgtgaggctaatcgactcaaaactgtcctgagtgcc
aatgctgaccacatggcacagattgagggcctcatggatgacgtggacttcaaggcaaaa
gtgactcgagtggagtttgaagagctgtgtgcagacctatttgagcgggtgcctgggcct
gtgcagcaggccctccagagtgccaaaatgaatttggatgagattgagcaggtgatcttg
gtaggtggggccactcgggtccccaaagttcaggaggtgctgctgaaggctgtgggcaag
gaggagctggggaaaaacatcaatgcagacgaggcagccgctatgggggctgtgtaccag
gcagccgcactcagcaaagccttcaaggtgaagccgtttatagtccgagatgcagtgatg
taccccatcctggttgagttcacaagggaggtggaggaggagcctggagttcgaggcttg
aagcacaataggcgtgtcctcttctcccggatggggccctatcctcagcgcaaggttatc
acctttaaccgctacagccatgactttagcttccacgtcaactacggtgacctgggcttc
ctggggcccgaggatcttcgggtatttggctcccagaatctgaccacagtgaagctaaaa
ggtgtgggtgagagcttcaagaaatatcccaactatgagtccaagggcatcaaagctcac
ttcaacctggatgagagtggtgtcctcagcctagacagggtggaatctgtgtttgagacc
ctggtggaagacagcccagaagaggaatcgactctgaccaaacttggcaacactatctcc
agcctgtttggaggtggtaccacaccagataccaaagagaatggtaccaacaccgtccag
gaggaagaggaaagccttgctgaggggagcaaggatgatcctggagagcaagcggagctc
agggaggaaggcgaggccccagtggaagacacctctcggcccccatcacctgagcctaag
gggaatatagccccagagggagaaaagcccgtagacaaagaaaatggggaaaagcctgag
gcccagaagccaagtgacaagggggaggcagggcctgagggtgtccctgcagccccagag
gaagacaagaagcagaagccttctcggaagcagagggcggtggaggagatcggagtggag
ctgcttgttctggacctacctgacttgtccgagagtgagctggcccgttcagcacagaaa
cttcaggacttgacagtccgagatctggagaagcaggaacgggagcaagctgccaacagc
ttggaagctttcatctttgagacccaggacaagctgtaccagccagagtaccaggaagtg
tccactgaggagcagcgtcaggagatctctgggagactcagcgctgcttccacttggctg
gaggatgagggctttggggccaccacagtgatgttgaaggagaagctggctgagctaagg
aaactgtgccaagggttgttttttcgggtagaagagcgtaagaagtggcctgagcggctg
tctgcccttgataatctcctcaaccattccagcatgttcctcaagggggcccggcttatc
ccagagatggaccagatcttcactgaggtggagatgacaaccttagagaaagtcatcaat
gagacctgggcctggaagaatgcaacgatggccgagcaggccaagcttcccactacagag
aaaccagtgttgctctccaaagacatcgaggccaagatgatggctctggaccgtgaggtg
cagtatctgctcaacaaagccaagtttgccaagccccggcccaggcccaaggacaagaat
gaaacccaggcagaacctccactcaatgccagtgaccagggggagaagatcatccatcca
ccaggccagactgaagatgcaaagcccctttcagaacctgagaaagaaattcgatctgag
ccagcagacactgaacctctggagttagaaggtcctagagcagaatctgaacaggaggag
cagcctccacgacagaagccagtgttgaagaatgatgaactataa

DBGET integrated database retrieval system