KEGG   Miniopterus natalensis: 107530269
Entry
107530269         CDS       T05883                                 

Gene name
MYBPC3
Definition
(RefSeq) myosin-binding protein C, cardiac-type
  KO
K12568  myosin-binding protein C, cardiac-type
Organism
mna  Miniopterus natalensis
Pathway
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107530269 (MYBPC3)
   05414 Dilated cardiomyopathy
    107530269 (MYBPC3)
SSDB
Motif
Pfam: I-set Ig_3 fn3 ig Ig_2 V-set THB C2-set_2 C1-set Ig_6 PKD_3
Other DBs
NCBI-GeneID: 107530269
NCBI-ProteinID: XP_016059442
LinkDB
Position
Unknown
AA seq 1367 aa
MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASDKFGLAAE
GTRHTLTVRDVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMPDPVPAPAPAPAEAPGV
PGETLASATEAEGGSPSPEGSSSAAPNGPDAPDDPIGLFVTRPQDGEVTVGGSIIFSARV
AGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQATFAGGYR
CEVSTKDKFDSCNFNLTVHEAIGPGDLDLRSAFRRTSLAGGGRRISDSSEDAGILDFSSL
LKKSSSFRTPRDSKLEAPAEDDVWEILRQASPSEYERIAFQHGVTDLRGMLKRLKGMKRD
EKKSTAFQKKLQPAYQVDKGHKIRLTVELADPDAEVKWLKNGQEIQMSGSKYIFESNGAK
RTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLIMRPLEDQLVMVGQRVEFECEVS
EEGAQVKWLKDGVELTREETFKYRFKKDGRRHHLIINEATLEDAGHYALRTSGGQALAEL
IVQEKKLEVYQSIADLTVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRV
HKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRKPDT
IVVVAGNKLRLDVPISGDPAPTVIWQKTVTQGKKVPAGPEPDAPGDAGASDEWVFDKKLL
CETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP
KISNVGEDSCTVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRDLRHEARRMIE
GVVYEMRVYAVNAIGMSRPSPASQPFMPVGPPSEPTHLTVEDISDTTVSLKWRPPEREGA
GGLDGYSVEYCQEGCSEWVAALQGLTERTSMLVKDLPTGARLLFRVRAHNVAGPGAPATT
KEPVTVQEILQRPRLQLPRHLRQTIQRRVGEPVNLLIPFQGKPRPQVTWTKEGQPLTGEE
VSIRNSPTDTILFIRAARRAHSGTYQVTLRIENMEDKATLVLQIVDKPSPPQDIRVTEAW
GFNVALEWKPPQDDGNTEISGYTVQKADKKTMEWFTVLEHYRRTHCVVSELIIGNGYYFR
VFSHNMVGPSDQAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTHPLVNRSIIAGYNA
TLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCTYDGGVYVCRATNL
QGEAQCECRLEVRGEEPTGPGPGVLEKAGHGLDSAILGQAAALAEGAMTAMSRRYNRMPT
MCQERGRKLDKPPSCCGYVCKCVPWGWLGASVGQCIDNEQAWGDYAD
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgcctgagcccgggaagaagccagtctcagccttcagcaagaagccacggtcagtggag
gtggccgccggcagccctgccgtgttcgaggccgagacagagcgggcaggagtgaaggtg
cgctggcagcgagggggcagtgacatcagtgccagcgacaagtttggcctggcagccgag
ggcacgaggcacacgctgacagtgagggacgtgggccctgctgaccaggggtcttatgca
gtcatcgcgggctcctccaaggtcaagtttgatctcaaggtcatagaagcagagaaggca
gagcccatgccagaccctgtccctgcccctgcccctgcccctgctgaggctcctggagtt
cccggagaaaccctggcttcagccactgaggcagaaggaggctccccaagtcctgaaggg
tcaagttcagcagcccccaatggccctgatgcccccgatgaccccattggcctctttgtg
actcgaccacaagatggcgaggtgactgtgggcggcagcatcatcttctcagcacgtgtg
gcgggggctagcctcctgaagccgcctgtggtcaagtggttcaagggcaagtgggtagac
ctgagcagcaaggtgggccaacacctgcagctgcacgacagctacgaccgggccagcaag
gtctacctgtttgagctgcacatcaccgatgcccaagccacctttgctggaggctaccgc
tgtgaggtgtccaccaaggacaaatttgacagctgcaacttcaatctcaccgtccatgag
gccattggccctggagacctggacctccggtcagctttccgccgcacgagtctggctgga
ggtggtcggcggatcagtgacagcagcgaggacgccgggattctggacttcagctcgctg
ctgaagaagagcagcagtttccggaccccgagggactcaaagctggaagccccggccgag
gatgacgtgtgggagatcctgcggcaggcgtccccttccgagtacgagcgcattgccttc
cagcatggggtcaccgacctgcggggcatgctcaagaggctcaagggcatgaagcgtgat
gagaagaagagcacagcctttcagaagaagctgcagccggcctaccaggtggacaagggc
cacaagatccggctgacggtagagctggccgaccctgacgccgaagtcaagtggctgaag
aatggacaggagatccagatgagcggcagcaagtacatctttgagtccaatggggccaag
cgcacgctgaccatcagccagtgctcgctggccgacgacgcggcctatcagtgcgtggtg
ggcggcgagaagtgcagcactgagctctttgtcaaagagccccctgtgctgatcatgagg
cccctggaggaccagctggtgatggtggggcagcgggtggagttcgagtgcgaggtgtct
gaggagggggcccaggtcaaatggctgaaggacggggtggaactgactcgggaagagacc
ttcaagtaccggtttaagaaggacggccggagacaccatctgatcatcaacgaggcgacg
ctggaggacgctgggcactacgcactgcgcaccagtgggggccaggcactggccgaactc
atcgtgcaggagaaaaagctggaggtgtaccagagcatcgcggacttgacagtgggcgca
aaggaccaggccgtattcaagtgcgaggtgtcagatgagaatgtgcggggcgtgtggctg
aagaacgggaaggagctggtgcctgacagccggataaaggtgtctcacatcgggcgggtc
cacaaactgaccattgacgacgtcactcctgcggacgaggctgactacagcttcgtgcct
gagggcttcgcctgcaatctgtccgccaagctccacttcatggaggtcaagattgacttc
gtgcctaggcaggaacctcccaagatccacctggactgcccaggccgcaaaccggacacc
atcgtggttgtggctgggaacaagctgcgcctggacgtccctatctccggggaccctgct
cccactgtgatctggcagaaaacagtcacacaggggaaaaaggtcccagctgggccagag
cctgatgccccaggggatgcaggtgcaagtgatgagtgggtgtttgacaagaagctcctg
tgtgagactgagggccgggtccgagtggagaccaccaaggaccgcagcatcttcactgtt
gaaggggcagagaaggaagacgagggtgtctacaccgtcacggtgaagaaccctgtaggc
gaagaccaggtcaacctgacagtcaaggtcatcgacgtgccggatgcccctgcggccccc
aagatcagcaacgtgggggaggactcctgcacggtgcagtgggagccgccggcctatgat
ggtggacagccggtcctgggttacatcctggagcgcaagaagaagaagagctaccggtgg
atgcggctgaacttcgacctgctgcgggacctgaggcatgaggcgcggcgcatgatcgag
ggcgtggtgtacgagatgcgagtctatgcagtcaatgccatcggcatgtccaggcccagc
cctgcctcccagcccttcatgcccgttggccctcccagcgagcccacccatctcacggtg
gaggatatctcagacaccaccgtgtccctcaagtggcggcctccggagcgcgagggagct
ggaggcctggacggctacagtgtggagtactgccaggagggctgctccgagtgggtggct
gccctgcaggggctgacagagcgcacatcaatgctggtgaaggacctgcccacgggggcc
cggctgctcttccgggtgcgggcacacaatgtggcagggcctggagcccccgccaccact
aaggagcccgtgacggtgcaggagatactgcagcggccacggcttcagctgcccaggcac
ctacgccagaccatccagaggagggttggggagcccgtgaacctcctcattcctttccag
ggcaagccccggcctcaggtgacctggaccaaagaggggcagccactgacaggtgaggag
gtaagcatccgcaacagccccacggacaccatcctcttcatccgggccgctcgccgcgcc
cactctggcacctaccaggtgacgctgcgcatcgagaacatggaagacaaggcaacactg
gtcctgcagattgttgacaagccaagccctccccaggacattcgggtcacggaggcatgg
ggtttcaatgtggctctggagtggaagccaccccaagatgatggcaatacagagatctca
ggttacacggtacagaaagctgacaagaagaccatggagtggttcacggtcctggagcat
taccgccgtacccactgtgtggtgtcagagctcatcatcggcaatggctactacttccgg
gtcttcagccacaacatggtggggcccagtgaccaagctgccaccaccaaggaacctgtc
ttcatccccagaccaggcattacatatgagccacccaactacaaggccctggacttctcc
gaggccccaagcttcacccaccccctggtgaaccgctccatcatcgccggctacaatgct
actctctgctgtgccgtccgggggagccccaagcccaagatttcctggttcaagaatggc
ctggacctgggagaagacgcccgcttccgcatgttcagcaagcagggtgtgctgaccctg
gagatcagaaagccctgcacctatgacgggggtgtctacgtctgcagggccaccaactta
caaggcgaggcccagtgtgagtgccgcctggaggtgcgaggtgaggagcccactgggcca
gggcctggggtgctggagaaggcagggcacgggctggactctgctattctgggccaagca
gctgctctggctgaaggagccatgaccgccatgtccagacggtacaaccggatgccaacc
atgtgccaggagcggggaaggaagctggacaagcctccttcctgttgtggatatgtgtgc
aagtgtgtaccttggggctggctgggagcatcagtagggcagtgtattgacaacgagcag
gcctggggggactatgcagactga

DBGET integrated database retrieval system