KEGG   Miniopterus natalensis: 107530503
Entry
107530503         CDS       T05883                                 

Gene name
ESAM
Definition
(RefSeq) endothelial cell-selective adhesion molecule
  KO
K06787  endothelial cell adhesion molecule
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107530503 (ESAM)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107530503 (ESAM)
SSDB
Motif
Pfam: V-set Ig_3 I-set Ig_2 ig Ig_6 Receptor_2B4
Other DBs
NCBI-GeneID: 107530503
NCBI-ProteinID: XP_016059762
LinkDB
Position
Unknown
AA seq 383 aa
MGPGKTMVALPGFPATTLLLVLFLGLNTFAPAACAQLQLHVPSGFASLHVPEGAEVVLPV
WYTFPGEVASARPWEKLTLMWFLEQKGKDMKQVLAHISGDTSSLPGVSLVYPMPSRNVSL
RLQGLQEKDSGSYLCSVNVQDHQGKSRGHASKTLHLQVLVPPAPPSCHVLGEPHAGTNVT
LSCKSPRSKPPAEYQWERLLPAPEVFFAPFLDTNRGTLNLRNLSSSMSGLYTCRAYNEVG
SASCNMTLTVNTGPGPAVIAGAVVGTLLGLGLLTGVVLLYQRQGKALEEPANDIKEDAIA
PRTLPWPKGSDTISKNGTISSITSSPALKPPHGPPRPGASTPTPGLHRSTPTPSAGGVSS
SALSRKGAVPVMVPAQNQAGSLV
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggggccagggaagaccatggtggccctgcctgggttccctgcgaccaccctgctgctg
gttttgttcctggggctgaacaccttcgcgcccgccgcgtgcgcccagctccagctgcac
gtgccttcgggcttcgccagcctgcacgtccccgagggcgcggaggtggtgctcccggtg
tggtacacctttccaggggaggtggcgtcggcgcgaccgtgggagaagctcaccttgatg
tggttcttggaacagaaggggaaggatatgaagcaggtgttggcgcacatcagcggggac
acatcaagcctacctggagtatccctggtctaccccatgccctcccggaatgtgtccctg
cggctgcagggcctgcaggagaaagactccgggtcctacctctgttctgtgaatgtgcaa
gaccatcaaggcaaaagcaggggccacgccagcaaaactttacatctccaagtgttggtt
cctccagctcctccatcctgccatgtcctgggtgagccccatgcggggaccaatgtgacc
ctgagctgcaagtccccaaggagtaagccccctgctgaataccagtgggagcggttactc
ccagctcctgaggttttctttgcaccatttttagataccaaccgtgggactttaaacctc
cgaaacctttccagttctatgtctggactctatacctgccgggcctacaatgaggtgggc
agtgccagctgcaatatgaccctgacagtgaacacagggcctgggcctgcagtgattgct
ggagctgttgtgggcaccctgcttggattggggctgctcactggagtggtactcttgtac
caacgccagggcaaagccctagaggagcctgctaatgatatcaaggaagatgccattgct
cctcggaccctgccctggcctaagggctcagacacaatctccaagaatgggaccatttcc
tctattacctcatcaccagctctcaaaccaccccatggccctcccaggcctggtgcatca
acccccacgcccggccttcatagatcaacccccacacccagcgctggtggggtctcctcc
tctgctctgagtcgcaagggtgctgtccctgtgatggtgcccgcccagaatcaggctggg
tctctggtgtga

DBGET integrated database retrieval system