KEGG   Miniopterus natalensis (Natal long-fingered bat): 107530559
Entry
107530559         CDS       T05883                                 
Symbol
UFD1L
Name
(RefSeq) ubiquitin fusion degradation protein 1 homolog
  KO
K14016  ubiquitin fusion degradation protein 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107530559 (UFD1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mna03009]
    107530559 (UFD1L)
Ribosome biogenesis [BR:mna03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control complex
    107530559 (UFD1L)
SSDB
Motif
Pfam: UFD1 CDC48_2
Other DBs
NCBI-GeneID: 107530559
NCBI-ProteinID: XP_016059842
LinkDB
Position
Unknown
AA seq 307 aa
MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLN
ITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVA
TYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAV
SIIECDMNVDFDAPLGYKEPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKK
GVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLIKKVEEDEVGGRFVAFSGEGQSL
RKKGRKP
NT seq 924 nt   +upstreamnt  +downstreamnt
atgttctctttcaacatgtttgaccacccgattccccgagtcttccagaaccgcttctcc
acgcagtaccgctgcttctccgtgtccatgcttgcagggcctaatgacaggtcagatgtg
gagaaaggcgggaagataattatgccaccctcagccctcgatcaactcagccgactcaac
attacttatcccatgctgttcaaactgaccaacaagaactcggaccgcatgacacactgc
ggtgtgctggaatttgtggctgatgagggtatctgctacctaccacactggatgatgcag
aatttgctgttagaagaaggaggcctggttcaagtggaaagcgtcaaccttcaagtggcc
acatactccaaatttcagcctcagagccctgacttcctggacattaccaaccccaaagca
gtattagaaaatgcattgaggaactttgcctgtctgaccactggggatgtgattgccatc
aactacaacgagaagatctatgaactgcgggtgatggagactaagcctgacaaggctgtg
tcgatcatcgagtgtgacatgaatgtggattttgatgctccactgggctacaaagaacct
gaaagacaagtccagcatgaagagtcaactgaaggcgaagctgaccatagcggctatgct
ggcgagctgggcttccgtgccttctctggctccgggaatagactggacgggaagaagaaa
ggtgtagaacccagcccctccccaatcaagcctggagacattaaaagaggaattcccaat
tatgagtttaaacttggtaagatcactttcatcagaaattcacgtccactgatcaaaaag
gttgaagaggatgaagttggaggcagattcgttgctttctctggagaaggacagtcattg
cgtaaaaagggaagaaagccttaa

DBGET integrated database retrieval system