KEGG   Miniopterus natalensis: 107530700
Entry
107530700         CDS       T05883                                 

Gene name
PECAM1
Definition
(RefSeq) platelet endothelial cell adhesion molecule isoform X1
  KO
K06471  platelet/endothelial cell adhesion molecule
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04670  Leukocyte transendothelial migration
mna05144  Malaria
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107530700 (PECAM1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107530700 (PECAM1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    107530700 (PECAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107530700 (PECAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107530700 (PECAM1)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107530700 (PECAM1)
   04091 Lectins [BR:mna04091]
    107530700 (PECAM1)
CD molecules [BR:mna04090]
 Proteins
  107530700 (PECAM1)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   107530700 (PECAM1)
Lectins [BR:mna04091]
 I-type lectins (Siglecs)
  107530700 (PECAM1)
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_C17orf99 ig I-set Izumo-Ig DUF6479 V-set_CD47
Other DBs
NCBI-GeneID: 107530700
NCBI-ProteinID: XP_016060076
LinkDB
Position
Unknown
AA seq 727 aa
MLLELTKEGKMWLGALLALLLCSSLEGQENSFTINRIHMVVLPGLEVQNGANLTLQCVVD
ISTTSQVKPQYQLLFYKDDTLFHNVSTTENAESYFIPQARVYNAGIYKCTVILDNKVKTT
PEHYVTVRGVAHPRVTLDKKEAIEGGVVMVNCSVPEEKAPVYFTVKKVELDTRAVKQHKE
KTSQHQNFVMLDFTVEEQDRMIYFLCQASIFSGKQVETSTTTRSDLVTVRESFSNPKFYI
DPDGVITEGDQLTIKCTIQVTHSAPTFPEIIIQKDKAIVAHSKLKNEASYSVMAMAEHNG
NYTCKVETSQISKVSSIVVNVTELFSKPKLESSATHLDQGDSLSLWCSVPGAPEINFAIK
KGHENVSQAQNFTTKASKWDSGIYTCVAGIGKVFKFSNAVQITVCEMLSKPRIFHDSTSE
VIKGQTIEIRCQSINGTFPISYHLLKASNTLESYTIDSNEPAVFKDNPTEDTEYQCLADN
CHSHLEMASEILSVKVIAPVAEVKLSILNKKKVESGKELVLRCFVNEASGPITYKFYKEK
EAKPFHEITSNDTQAFWYKTQASVEEEGQYYCTAANRANPAKNIPQSNVLAVRVFLAAWK
KGLIGVAVVAVLIAILVLGVKCYFWKKAKAKQMPVEMSRPAAPLLTSNNEKMSGSSTEAN
RPYGYNEETGNHAMKPVTENKDPLTLDVEYTEVEVNSLEPHKVLKMKGTDTVYSEIRKAK
PENGKLP
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgctgctggagctgactaaagagggcaagatgtggctgggagccctgctggcgcttctg
ctctgttcaagcctcgagggtcaagaaaactctttcaccatcaaccgcatccacatggtg
gtcctgccagggctggaggtgcaaaacggggcgaacctgacccttcagtgcgtcgtggac
atcagcaccacttcccaggtcaagcctcagtaccagctgctcttctataaggatgacacg
ctgtttcacaacgtctccaccacggagaacgcagagagttatttcatccctcaagcccgg
gtctacaacgcgggaatatacaaatgcactgtgattctggacaacaaggtgaaaaccaca
ccggagcactacgtgacagtgagaggagtggcccatcccagagtgacactggacaagaag
gaggcgatagaaggcggggtcgtgatggtcaattgctctgtcccagaggaaaaggccccg
gtatatttcacagtcaaaaaagttgaactggacacaagagctgtcaagcaacacaaagaa
aaaacttctcagcaccagaattttgtgatgctggacttcacagtcgaggagcaggaccgt
atgatctatttcctatgtcaagccagcatcttttctgggaaacaagtggagacctctaca
accaccaggagcgatctggtcaccgtgagggaatccttctccaatcccaagttctacatc
gacccggacggggtgatcactgaaggagatcagctgactattaagtgtaccattcaagtg
acgcacagcgccccgacctttccggaaatcataatccagaaggacaaggcaatcgtggcg
cacagcaagctgaaaaacgaggcctcctactcagtaatggccatggcggagcacaatggc
aactacacgtgcaaagtggaaaccagccagatatccaaggtcagcagcatcgtggtcaac
gtaacagagctattttccaaaccgaagctggaatcttccgccacacatttggaccagggt
gacagcctgagtctgtggtgctctgtcccaggagcacctgaaatcaacttcgccatcaag
aagggacacgagaatgtgtctcaggctcaaaatttcaccacgaaagcctcaaaatgggac
agtgggatatacacctgtgtcgcaggcatcggcaaggtgttcaaatttagcaacgcagtg
cagataaccgtgtgtgaaatgctctccaagcccaggattttccatgactccacgtctgag
gtgataaaaggacagaccatcgaaatccgctgccaatccataaatggaacctttcctatt
tcttatcaccttttaaaagcaagtaacactttggagagttacaccatagactcaaatgag
cccgcagtattcaaagataaccccacagaagacacagaataccagtgcctggcggataat
tgccattcccatctcgaaatggccagtgagattctgtcggtcaaggtgatagctccggtg
gctgaggtcaagctctctatcttgaataagaagaaagtggagtctgggaaagaacttgtg
cttcgatgcttcgtgaacgaagcgtctggtccaatcacctataagttttacaaagaaaag
gaggcgaagcccttccacgaaatcacctcgaatgacacccaggccttttggtacaagaca
caggctagtgtcgaagaggagggacagtattactgcacggccgccaacagagccaaccct
gccaaaaacatcccccaaagcaacgtattggcagtcagagtctttcttgccgcatggaag
aaaggacttattggagtggctgtcgtcgcagtgttaattgccatcttggtacttggggtc
aagtgctatttttggaagaaagccaaggccaagcagatgccagtggagatgtccaggccg
gcagcaccacttctgacctccaacaatgagaagatgtcaggctccagcacagaagccaac
aggccttacggttacaatgaagagactggaaaccacgcaatgaaaccagtaacagaaaat
aaagaccctctgaccttggacgtggagtatacagaagtggaagtgaactcactcgaacct
cataaagttctgaaaatgaagggcacggatacagtgtacagtgaaatcaggaaagctaag
cctgaaaacggaaagctcccttga

DBGET integrated database retrieval system