KEGG   Miniopterus natalensis: 107530873
Entry
107530873         CDS       T05883                                 

Gene name
CD40
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 5 isoform X1
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04064  NF-kappa B signaling pathway
mna04514  Cell adhesion molecules
mna04620  Toll-like receptor signaling pathway
mna04672  Intestinal immune network for IgA production
mna05144  Malaria
mna05145  Toxoplasmosis
mna05166  Human T-cell leukemia virus 1 infection
mna05169  Epstein-Barr virus infection
mna05202  Transcriptional misregulation in cancer
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05322  Systemic lupus erythematosus
mna05330  Allograft rejection
mna05340  Primary immunodeficiency
mna05416  Viral myocarditis
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107530873 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107530873 (CD40)
   04514 Cell adhesion molecules
    107530873 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107530873 (CD40)
   04672 Intestinal immune network for IgA production
    107530873 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107530873 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107530873 (CD40)
   05169 Epstein-Barr virus infection
    107530873 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    107530873 (CD40)
   05145 Toxoplasmosis
    107530873 (CD40)
  09163 Immune disease
   05310 Asthma
    107530873 (CD40)
   05322 Systemic lupus erythematosus
    107530873 (CD40)
   05320 Autoimmune thyroid disease
    107530873 (CD40)
   05330 Allograft rejection
    107530873 (CD40)
   05340 Primary immunodeficiency
    107530873 (CD40)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107530873 (CD40)
   05416 Viral myocarditis
    107530873 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107530873 (CD40)
   04090 CD molecules [BR:mna04090]
    107530873 (CD40)
Cytokine receptors [BR:mna04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107530873 (CD40)
CD molecules [BR:mna04090]
 Proteins
  107530873 (CD40)
SSDB
Motif
Pfam: TNFR_c6 Glycophorin_A RANK_CRD_2
Other DBs
NCBI-GeneID: 107530873
NCBI-ProteinID: XP_016060279
LinkDB
Position
Unknown
AA seq 275 aa
MGRLPLPCLLLGSLLSAVHLEPCGERQYLKSQCCDMCPPGHKLVNDCTAVSNTECLPCSE
GEFLKTWNSEKRCHQHRYCDPNLGLRVQSNGTSQTDRTCTCNEGQHCVNEACETCTPHSS
CPPGFGVKEIATGVSDTICEPCLVGFFSNVSSAFEKCHPWTSCETKGLVEVRAGTNKTDA
ECGFRPRMRALVVIPVVAVVLFIVLFVSACIRKVTKEGHNKAFHPKGKRQDPVEIDLEDF
SGPCSTAPVQETLHWCQPVAQEDGKESRISVQERQ
NT seq 828 nt   +upstreamnt  +downstreamnt
atgggccgcctgccgctgccgtgtctcctcctgggctccctgctcagcgccgtccaccta
gaaccatgcggtgaacgccaatacctaaaaagtcaatgctgtgatatgtgcccgccagga
cacaaactggtgaatgactgcacggctgtcagcaacacagaatgcctcccttgtagtgaa
ggcgaattcttgaagacttggaacagtgagaagcgctgtcatcagcacagatattgtgac
cccaacctagggctccgggtccaaagtaacggcacttcacaaacagacaggacttgcaca
tgtaatgaaggccaacactgtgtcaacgaggcctgtgaaacctgcaccccgcacagctct
tgcccccctggctttggggtcaaggagattgctacaggggtttctgataccatctgtgaa
ccctgcctggtcggcttcttctccaatgtgtcatctgcttttgaaaagtgtcatccttgg
acaagctgtgagaccaaaggtctggtggaggtgcgggcagggactaacaagactgatgct
gaatgtggtttccggcctcggatgagagccctggtggtgatccccgttgttgcagtagtc
ctgtttattgtcctattcgtgtctgcctgtatcagaaaggtgactaaggaggggcacaat
aaggccttccaccctaagggcaaaaggcaagatcctgtggagatagacttggaggatttt
tctggtccctgctctacggctccggtgcaggagaccttacattggtgccagccggtcgca
caggaggatggcaaagagagccgcatctcagtgcaggagagacagtga

DBGET integrated database retrieval system