KEGG   Miniopterus natalensis: 107530937
Entry
107530937         CDS       T05883                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2
  KO
K05637  laminin, alpha 1/2
Organism
mna  Miniopterus natalensis
Pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04512  ECM-receptor interaction
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05222  Small cell lung cancer
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107530937 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107530937 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107530937 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530937 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107530937 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107530937 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107530937 (LAMA2)
   05145 Toxoplasmosis
    107530937 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107530937 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107530937 (LAMA2)
   05414 Dilated cardiomyopathy
    107530937 (LAMA2)
   05416 Viral myocarditis
    107530937 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 CAMSAP_CC1 DUF948
Other DBs
NCBI-GeneID: 107530937
NCBI-ProteinID: XP_016060358
LinkDB
Position
Unknown
AA seq 3129 aa
MPGAAGVLLVLLLSRGLGGAQAQPLPPLPQAHQQRGLFPAVLNLATNARITTNATCGEKG
PEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIEYH
YVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDADYKPWQYHAVTDAECLTLYGI
YPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIR
LRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPVT
NKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDENVARR
NLSLNIYGKYIGGGVCINCTQNTAGINCETCIDGFFRGKGVSPSDPGPCQPCHCDPVGSS
TEVCVKDEKRAPRGLEPGSCHCKPGFAGKRCERCARGYTGFPACKPCNCSGEGSANEDPC
LGPCNCKENVEGADCRRCKPGFFNLQERNAKGCDECFCSGVSTRCQSSYWPYGSIQDMSG
WSLTDISGHTRVAPQQDLQPPQHISISSSEARRALPQDYYWSAPAPYLGNKLTAAGGQLT
FTVSYDLEEEDTARRRSLQSTIILEGKDLRISTAQEEVHLKPSEDHIYKLSLKEESFTIH
GTNVPVSRKEFMTVLVDLQRVLIQTTVSLGVDAIYRLSSVGLDSAVPYPTDGSTASAVEV
CQCPPGYTGSSCEKRHQANASSNLIPASNAKSCWPRHRRVNGTIFGGICEPCQCFGHAES
CDDITGECLNCKDHTGGPYCNKCLPGFYGDPTKGTSEDCLPCTCPLNIPSNNFSPTCHLD
RSLGLICDECPVGYSGPRCERCAEGYFGQPSVAGGSCQPCQCNDNLDFSIPGSCDSLSGS
CLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNANGSLSEVCHTRTGQCECRPNVQG
QRCDECKPETFGLHSARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFN
FQEGGCTACDCSHLGNNCDPNTGQCICPPNTIGDQCSQCVPNTWGHSIVSGCKACNCSTV
GSLDFQCNINTGQCNCHPKFSGAQCTECSRGHWNYPHCDPCDCFLPGTDDATCDLGTKKC
SCIDRTGQCTCKVNVEGVHCDRCRPGTFGLDAKNPLGCSSCYCFGATTQCSEAEGLIRTW
VALEPEQTILPLVDEALQHTTTKGIAFQDPEIVAHMDLVRQDLHLEPFYWKLPEQFEGKK
LMSYGGKLKYAIYFEAREETGFSTYNPQVIIRGGTPSHARIIVRHMAAPLIGQLTRHEIE
MTEKEWKYYGDDPRVSRTVTREDFLNVLYDIHYILIKATYGNVMRQSRISEISLEVAEQG
TVTAVTPAAHLIERCDCPPGYSGLSCETCTPGFYRLRSGPGGRTPGPALGTCVPCQCNGH
SSLCDPETSICQNCQHHTAGDFCEQCAIGYYGIVKGLPNDCQQCACPLISPSNNFSPSCV
MEGPDDFRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSVPVPCDSVTGL
CKCRPGATGPKCDGCEHWHAREGTECVFCGDECTGLLLGDLEHLEQVVTSVNLTGPLPAP
YRMLYSLENTTQELKHLLSPQRAPERLVQLAEGNLNTLVTEMNELLTRATKVTADGEQTG
QDAERTNTRANSLGEFIKELVRDAEAVNEKAIKLNETLGIQDKAFERNLQELQKEIDQMM
GELRRKNLDAQKEVVEDELVAAEGLLKKVRRVFGEPRGRNEGLENELRGKLTHHKDQLDD
ARGLLREAMNKVREANRLSSANQENMTALEEKKEAIENGKRQTENTLKEGNDILDEANRL
ADGINSVIDYVKDIQTKLPPMSEELKDKIDDLSQEMKDRKLAEKVFQAENHAAQLNNSSA
VLDGILDEAKNISFNATAAFKAYSNIKDYIDEADQIAKGAKGVAHEATKLATGPQGSLKE
GAKGSLQKSFGILNEAKKLANTVKENDDHLKGLQTRLENADVRNGDLLRALNDTLGKLSA
IPNDTAAKLLAIKNKARQANDTAKDVLVQIKDLHQNLDGLKKNYNQLADSVARTNAVVKD
PSKNKIIADADATVKNLEQEADRLINKLKPIKELEDNLKRNISEIKELINQARKQANSIK
VSVSSGGDCIRTYKPEIKKGSYNNIIVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVS
FLWDVGSGVGRVEYPDLTIDDSYWYRIEASRTGRNGTISVRALDGPKASIVPSTYHSASP
PGYTILDVDANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDSKPIGLWNFREIEGDC
KGCTVSPQVEDSEGTIQFDGEGYAMVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDL
KDFMSVELTDGHIKVSYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIIDIDTNQ
EENIATSSPGNNFGLDLKADDKIYFGGLPTLRNLRPEVNLKKYSGCLKDIEISRTPYNIL
SSPDYVGVTKGCLLENVHTVSFPKPGFVELAPVPINVGTEINLSFSTKNESGIILLGSGG
TPRRKRRQAGQAYYAVFLNKGRLEVHLSTGARIMRKIVVKPEPSLFHDGREHSVHVERAR
GIFTVQVDEDRRHTQNLTAEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCVWNLVINSV
PMDFARPVSFKNADIGRCAHQKPLEDGDGGVPAEVVIQPESVPTPAFPTPTPVLAHGPCA
VAPEPALLIGSKQFGLSKNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHAD
FATVQLRNGFPYFSYDLGSGDTNTMIPTKINDGQWHKIKITRIKQEGILYVDDASNRTVS
PKKADILDVVGILYVGGLPINYTTRRIGPVTYSIDGCIRNLQMAEAPADLEQPTSSFHVG
TCFANAQKGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRTTGVLLGVSSQKMDGMGIEM
IDEKIMFHVDNGAGRFTAVYDAGTPGHLCDGQWHTVTANKIKHRIELAVDGNRVEAQSPN
PASTSADTNDPVFVGGFPDGLNQFGLTINVPFRGCIRSLRLTKGTGKPLEVNFAKALELR
GVQPVSCPA
NT seq 9390 nt   +upstreamnt  +downstreamnt
atgccaggagccgccggggtccttctggtcctgctgctcagccggggcctcgggggtgcc
caggcgcagccgctgccgccgctgccacaggcgcaccagcaaagaggtttattccctgct
gtcttgaatcttgctactaatgctcgcatcaccacaaatgcaacatgtggagaaaaagga
cctgaaatgtactgcaaattggtagagcatgtgcctgggcagcctgtgaggaacccccaa
tgtcgaatctgtaatcaaaacagcagcaacccaaatcagagacacccaattacaaacgct
attgatggaaagaacacttggtggcagagccccagtattaagaatggaattgaataccat
tatgtgaccattacactggatttgcaacaggtgttccagatcgcgtatgtgatcgtgaag
gcagcgaactccccccggcctggaaactggatcctggaacgctccctggacgacgcggac
tacaagccctggcagtaccacgctgtgaccgacgccgagtgcctgaccctctacggcatt
tatccccgcaccgggcccccgtcctacgccaaggacgacgaggtcatctgcacctcgttt
tattccaagatacaccccttagaaaacggagagattcacatctctttgatcaatgggaga
ccaagtgcggatgacccctctcctgaactgctggaattcacctctgctcgttatattcgc
ctgagatttcagaggatccgcaccttgaatgccgatttgatgatgtttgctcacaaagac
ccaagagaaattgaccccattgtcacacgaagatattactactcggtcaaggatatttcg
gttggagggatgtgcatctgctatggtcatgccagggcttgtccacttgatccagtgaca
aataaatcccgctgtgaatgcgaacacaatacgtgtggcgacagctgtgaccagtgctgt
ccaggattccatcagaaaccttggcgagctgggacttttctgactaagagcgagtgtgaa
gcatgcaattgtcatgggaaagctgaagaatgctattatgatgaaaatgttgccagaaga
aatctgagtttaaatatatatggaaagtacattggagggggtgtgtgcatcaactgcacc
caaaacactgctggcataaactgtgagacatgtattgatggcttcttcagaggaaaaggg
gtttcaccaagtgatccaggaccctgccagccatgccattgtgatccagttggctcctcc
actgaggtctgtgtcaaggatgaaaagcgtgctccacgaggcctggaacctgggtcctgt
cattgcaaacctggttttgcagggaagagatgtgagcggtgtgccaggggctacactggc
ttccccgcctgcaaaccctgtaactgcagtggcgaaggaagtgcaaatgaagacccttgt
cttggaccctgtaactgcaaggaaaacgttgaaggagcagactgcaggcgctgcaaacct
ggcttcttcaatttgcaggagcgcaatgccaaaggatgtgacgagtgtttctgttcgggg
gtttccaccagatgtcaaagttcctactggccctatggcagcatacaagacatgagtggc
tggtccctgactgacatctcaggccacactcgagtggctccccagcaggacttacagcca
ccccagcatatcagcatcagcagctcggaggcccgccgcgccctgccccaggactactac
tggagcgcaccagctccgtatctgggaaacaaactcacagcagctggaggacaattgaca
tttactgtatcgtatgacctcgaagaagaagacacagcccgcagacgctcgctccagagc
acgattatcttagagggaaaagacttgagaatcagcacagcccaagaagaggtacatctg
aaaccatctgaagaccatatttataaattgtcactcaaagaagaatcatttaccatacat
ggtacaaatgttccagtcagtagaaaagagtttatgacagtgcttgtggatttacagaga
gtcctcatacaaaccacagtcagccttggggtggatgccatctacaggctgagctctgtt
ggccttgactctgccgttccctatcctacggatggaagcactgcgtcagctgtggaagtg
tgccagtgcccaccggggtacactgggtcctcttgtgaaaaaagacaccaagctaatgct
tcctctaatctcatacctgccagtaacgctaagtcttgctggcctaggcacagacgagtt
aacggcactatttttggtggcatctgtgaaccctgccagtgctttggtcacgcggaatcc
tgtgatgacatcaccggagaatgcctgaattgtaaggatcacacaggtggcccatactgc
aataaatgtcttcctggtttctatggagatcctactaaaggaacctctgaagactgcctg
ccctgtacctgtccactcaatatcccatcaaataactttagcccgacgtgccacttagac
cgaagtcttggattgatctgtgacgaatgccctgtcgggtactcaggaccacgctgcgag
aggtgtgcagaaggctattttggacaaccttctgtagctggaggatcatgtcagccatgc
caatgcaatgacaaccttgacttctccatccctggcagctgtgacagcttgtctggctcc
tgtctgatatgtaagccaggtacaacaggccggtactgtgagctctgtgctgatggatat
tttggagacgcagttgatgcaaagaactgtcagccttgtcgctgtaacgccaacggctcc
ttgtcggaggtttgccacactcggacaggacagtgtgaatgcagacctaacgtgcagggc
cagcggtgtgatgaatgcaagcctgaaacctttggcctacactcggcaagaggatgtgtt
ccctgcaactgtaattcctttgggtctaagtcattcgactgtgaagagagtggtcagtgt
tggtgccagcctggagtgacaggaaagaaatgtgaccgctgtgcccatggctacttcaac
ttccaagaaggagggtgcacagcttgtgactgttctcatctgggtaataattgcgaccca
aacactggtcaatgcatttgccctcccaataccattggagatcaatgttctcaatgtgta
cctaatacctggggccacagtatcgtctctggttgtaaggcttgtaactgtagcacggtg
ggatccttggatttccaatgcaatataaacaccggccagtgcaactgtcaccccaagttc
tctggtgcacaatgtacagagtgcagccgaggtcactggaactaccctcactgcgaccct
tgtgactgcttcctgcccgggacagatgatgcgacctgtgacttagggactaaaaaatgc
tcctgtatcgatcggactgggcagtgcacttgtaaggtgaacgtggaaggtgtccactgt
gacaggtgccggcctggcacattcggacttgatgctaagaacccacttggctgcagcagc
tgctattgcttcggagctactacccagtgctctgaagcagaaggactgatccgcacatgg
gtggctctggagccggagcagaccattctgcccctggtggatgaggcgctgcagcacaca
actaccaaaggcattgcttttcaagatcccgagattgttgcccacatggatctggtgaga
caagatctccatttggaacctttttattggaaactcccagaacaatttgaaggaaagaag
ttgatgtcctatgggggaaaactcaagtatgccatctattttgaggctcgagaagagaca
ggtttctctacatataatcctcaagttatcattcgaggtgggactccatctcatgctaga
attatcgttaggcatatggctgctcccctaattggccaattgacaaggcatgaaatcgaa
atgacagagaaagaatggaaatattatggtgatgatcctcgagtcagtagaactgtgacc
cgtgaagacttcttgaatgtactatatgatatccactatattcttatcaaggctacttat
ggaaatgtgatgagacaaagcaggatttctgaaatctcactggaggtagctgagcaagga
actgtaacagcagtgactcctgcagctcacttgatcgaaagatgtgactgtcctccgggc
tattctggtttgtcctgtgagacatgcacgccgggattttaccgactgcgctctgggcca
ggcggtcgcacgcctgggccagccctgggcacctgtgttccgtgtcagtgtaatggacac
agcagcctctgtgaccccgagacctccatatgccagaactgtcagcatcacactgctggt
gacttctgtgagcaatgtgctattgggtactacgggattgtcaagggattgccgaatgac
tgtcagcaatgtgcctgccctctgatttctcccagcaacaatttcagcccttcttgtgtc
atggaaggccctgatgatttccgctgcacagcttgtccacgtggatatgaaggccagtac
tgcgaacggtgtgcccctggctatactggcagcccaagcagccccggaggctcctgccaa
gaatgtgagtgtgatccctatggctcagtgcctgtcccctgtgactcggtcacagggctc
tgcaagtgccgacctggagccacggggcccaagtgtgatggctgcgagcactggcatgca
cgagagggcacggagtgtgttttctgtggagatgagtgcacgggccttcttctcggggac
ctggagcacctggagcaggtggtgacgagcgtcaacctcacaggcccgcttcctgctcca
tacaggatgctgtacagtctggaaaatacgactcaggaactaaagcacttgctctccccc
cagagggcgccagagaggctcgttcagttggcagagggcaatctgaacacacttgtgaca
gaaatgaatgagcttctgaccagggcgaccaaagtgacagcagatggcgagcaaactgga
caggatgctgagaggaccaacacaagagcaaactccttaggagaattcattaaggaactt
gtccgggatgcagaagctgtaaatgaaaaagctataaaactaaatgaaactctaggaatt
caagacaaggcctttgagagaaatttgcaagagcttcagaaagagattgatcagatgatg
ggggaattaaggaggaaaaatctagatgcacagaaagaagttgtggaagatgagttggtg
gctgcggaaggcctgctgaagaaggtgcggagggtgttcggggagccccgggggaggaac
gaaggcctggagaatgagctccgcgggaaactcacccaccacaaagaccagcttgacgac
gctcggggcctgctgagagaagccatgaacaaagtcagagaagctaatcgcttgtcttca
gccaaccaggagaacatgactgccctggaggaaaagaaagaggctattgaaaatggcaaa
cgacaaactgagaacactttaaaagaaggcaatgacatacttgatgaagccaatcgtctt
gcagatggaatcaactcagtcatagactatgttaaagacattcaaactaaattacctccc
atgtctgaagagctgaaagataaaatagatgacctctcccaagaaatgaaagataggaag
cttgctgagaaggtgttccaggctgagaaccatgcagctcaattgaacaactcatcggct
gtccttgacggaatccttgatgaggctaaaaacatctccttcaatgccactgcagccttc
aaagcttacagcaatatcaaggactatattgatgaagctgaccaaattgccaaaggagcc
aaaggtgttgcacatgaagctacaaaactggcaactggtcctcagggctcattaaaggaa
ggtgccaaaggctctcttcagaaaagcttcgggattcttaatgaagccaagaaattagca
aatactgtaaaagaaaatgatgaccatttaaaaggcttgcaaaccagattagaaaatgcc
gacgttagaaatggggatctcctgagagctctgaatgacactttgggaaagttatcagca
attccaaatgacacagccgctaaactactggccattaagaacaaagcaagacaagccaac
gacacggcaaaagatgtcctggtccagattaaagatctccaccagaacctggatggcctg
aagaaaaattacaaccaactcgcagacagcgtagccagaacaaacgctgtggtaaaagac
ccttcgaaaaacaaaatcattgcagatgcagatgccactgtgaaaaatctagaacaagaa
gctgatcgactgatcaataaactcaaacccatcaaggaacttgaggataacttgaagcga
aacatctctgagataaaggaactgataaaccaagcccggaaacaagccaattctatcaaa
gtatccgtgtcttcgggaggtgactgcatccgaacatacaagccagaaatcaagaaagga
agctacaataatatcattgtcaacgtgaagacagctgttgctgacaacctccttttttat
cttggaagtgccaaatttattgactttctggctatagaaatgcgaaaaggcaaagtaagc
ttcctctgggatgttggatctggagttggtcgtgtagagtatccagatttgactattgat
gactcctactggtaccgaattgaggcatcaagaactgggagaaacggaaccatttctgtg
agggccctggatggacccaaagccagcattgtgcccagtacataccattcagcgtctcct
ccggggtacacgattctagacgtggatgccaatgcaatgctcttcgttggtggcttgaca
gggaaattgaagaaggctgatgctgtgcgtgtgattacattcactggctgcatgggagaa
acatactttgacagcaaacccatagggttgtggaatttccgagaaatagagggtgactgc
aaaggatgtactgtcagtcctcaggtggaagacagtgagggaactattcagtttgatgga
gaaggctacgcaatggtcagccgccccattcgctggtaccccaacatctccacggtcatg
ttcaagttcaggacattttcttcaagtgctctcctgatgtaccttgccacaagagacctg
aaagatttcatgagtgtagagctcactgacgggcacataaaagtcagctatgatctgggt
tcaggaatggcttctgttgtcagcaatcaaaaccataatgatgggaaatggaaatcattc
accctctcaagaattcaaaaacaagccaacatatcaattatagatatagataccaaccag
gaggaaaacatagcaacttcatctcctggaaacaactttggtcttgacttgaaagcagat
gacaaaatatattttggtggcctgccaacgctgagaaacttgagaccagaagtaaatctg
aagaaatactctggctgccttaaagatattgaaatctcaagaactccatacaatatactc
agtagccctgattatgttggcgttaccaaaggatgtttgctggagaatgttcacacggtt
agcttccccaagcctggttttgtggagctggcgcctgtgccaattaatgtaggaacagaa
atcaacctgtccttcagcactaagaatgagtctgggatcatcctcctgggcagtggaggg
acacctcggagaaaacgaaggcaggctggacaggcctattatgcggtattcctgaacaag
ggccgcctggaagtgcacctctccacaggcgcacggataatgaggaaaatcgttgtcaaa
ccagagccgagcctgtttcacgacgggagagaacattccgttcatgtggagagagcgaga
ggcatcttcacggttcaagtggatgaagacagaaggcatacgcaaaacctgacggcagaa
cagccgatcgaagtcaaaaagcttttcgtgggcggtgctccacctgaattccaaccttcc
ccactcagaaacattcctccttttgaaggctgtgtatggaacctcgttatcaactctgtc
cccatggactttgcacggcctgtatccttcaaaaatgcagacattgggcggtgtgcccat
cagaaaccccttgaggatggagatggaggagttccagctgaagtagtcatccagccggag
tcagtgcccaccccagccttccccacgcccactcctgttctggcgcatggtccttgtgct
gtagcaccagaaccagctcttttgatagggagcaagcagttcgggctgtcaaaaaacagt
cacattgcaattgcatttgacgacaccaaagttaaaaaccgcctcacgattgaactcgag
gtacgaaccgaagctgaatcaggcttgctcttctacatggcacggatcaatcatgcggat
tttgctactgttcagctgagaaacggatttccctacttcagttatgacttaggaagcggt
gacaccaacaccatgatccccaccaaaatcaatgatggccagtggcacaagattaagatt
actcgaattaagcaagaaggaattctttacgtagatgacgcctccaacagaaccgtcagt
cccaagaaagctgatatcctggatgttgtggggatattgtatgttggtgggctacccatc
aactacactacccggagaattggtccagtgacctacagcattgatggctgcatcaggaat
ctacagatggcagaggcccctgctgacctggaacagccaacctccagcttccatgttggg
acatgttttgcaaatgctcagaaaggaacatattttgatggaacaggttttgccaaagca
gttggtgggttcaaagtggggttggacctccttgtagaatttgaattccgcacaactaga
accactggagttctcctgggagtcagcagccagaaaatggatggaatgggtattgaaatg
attgatgaaaagattatgtttcacgtggacaatggcgccggccggttcactgccgtctat
gatgccgggaccccagggcatctgtgtgacggacagtggcatacagtcaccgccaacaag
atcaaacaccgcattgagctggcagtagatgggaaccgggtggaagcccagagcccaaac
ccagcgtctacatcagccgacaccaatgaccctgtgtttgttggaggtttcccagatggc
cttaaccagtttggcctgacaatcaacgttccgttcagaggttgcatccgatccctgagg
ctcaccaaaggcaccggcaagccgctggaagtgaattttgctaaggccctggaactcaga
ggcgttcaacctgtatcatgcccagcttaa

KEGG   Miniopterus natalensis: 107535878
Entry
107535878         CDS       T05883                                 

Gene name
LAMA1
Definition
(RefSeq) laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
mna  Miniopterus natalensis
Pathway
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04512  ECM-receptor interaction
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05222  Small cell lung cancer
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107535878 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107535878 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107535878 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535878 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107535878 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107535878 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107535878 (LAMA1)
   05145 Toxoplasmosis
    107535878 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107535878 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107535878 (LAMA1)
   05414 Dilated cardiomyopathy
    107535878 (LAMA1)
   05416 Viral myocarditis
    107535878 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_B Laminin_I Laminin_N Laminin_II Laminin_G_3 Hepar_II_III
Other DBs
NCBI-GeneID: 107535878
NCBI-ProteinID: XP_016066945
LinkDB
Position
Unknown
AA seq 3025 aa
MFCKLVEHVPGRPVRNPQCRICDGHSANPKERHPISNAIDGTNNWWQSPSIQNGREYHWV
TITLDLRQVFQVAYIIIKAANAPRPGNWVLEHSLDGTRFSPWQYYAVSDTECLTRYNITP
RRGPPTYRADDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLR
LQRIRTLNADLMTLSHRDPKDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKK
LRCQCEHNTCGESCSRCCPGYHQQPWRPGTISSGNMCEECNCHKKAKDCYYDDSVANQKK
SLNTAGQYRGGGVCINCLQNTMGINCETCIDGYYRPHNVSPYEDNPCHPCDCNPLGSLSS
VCIKDDLHSDLHKGKWPGQCPCRGGYTGQKCDRCQFGYRGYPACVPCDCSPAGSVNEDPC
SEPCLCKENVEGENCDRCKPGFYNLKERNPQGCSECFCFGVSDVCDSLSWPISQVKDMSG
WLVTDLISPNKIPSQQDALGGRHQISVNNTAAMQRLTSKYYWSAPKAYLGNKLTAFGGFL
KYTVSYEFPVETVDSALVSYADVIIKGNGLTLSTQAEGLSLQPYEEYFNVVRLVPENFRD
FNNKREIDRDQLLTVLANVTHLLIRANYNSAKMALYRLDSVSLDTASPNVIDLALATEVE
HCECPQGYAGISCESCLSGYYRLDGILFGGICQPCECHGHAAECDIQGTCFACEHNTTGD
HCEQCLPGFYGRPTQGTPGDCQPCACPLSSASNNFSPTCHLDAGDEVVCDQCALGYSGTW
CERCADGYYGNPTVPGESCVPCNCSGNVDPLEAGHCDSVTGECLRCIGNTDGAHCERCAD
GFYGDAVTAKNCRACECHGKGSLSDVCHPKTGLCDCRAHVTGQQCDQCLHGYYGLDTGLG
CLPCDCSPGSMSDDCAEEGQCRCVPGVTGKRCDRCARGFYAFQDGGCKPCDCAHTQNTCD
PESGECVCPPHTRGVTCEECEDGYWGYDLELGCQACNCSSAGSASRHCDERTGHCQCKPI
FGGPSCDQCSLGFRDFPDCVACDCDLRGTLEDTCDEEQGLCSCAQETGTCSCKENVLGLQ
CSECRVGTYALHADNPRGCTPCFCFGLSQLCLELEGYVRMPITLGSDQPLLRVVSQSNLR
GTTHGVYYQAPDVLLDAVTVRKHVHAEPFYWRLPGQFQGDQLMAYGGKLKYSVAFYSSNG
MGTFNLEPQVLVRGGRTRKQVIYMDAPAPENGVRQEQEVEMKENYWKYFNSVSEKPVTRS
DFMSVLSNIEYILIKASYGQGLQQSRISNISMEIGRKADELHPGREAASLLEKCVCPPGT
AGLSCQDCAPGYYRGKLPEGGDRELRLLLAPCVPCSCNNHSDTCDPETGKCLNCSDNTSG
DHCDVCAPGYYGKVTGSATDCSLCTCPHGRPASFSPTCVLEGDGDFRCDACVPGHEGQYC
ERCSSGYHGNPRVPGGTCQSCDCSPRGSVHRDCDRGSGQCVCRPGAAGLRCEQCEPRHVL
VESNCIACDDECVGVLLNDLDSVGDTIHSVNLTSIIRVPHGILSNLENTTKDLRESLLKG
DIGKELLEFQLEGVTEQRDDLQRELTRVLTSSQQVARATERILSKSQDLTTFTEKLKISI
EEIIEKATTLNQTLGEDFQLPSSTLHIMQKNMTSLLETIQKRHFMQLHQNATIELKTAEN
LLSQIQKNYRKPQEESKVIKEAASSLLSKHNRELQAAEDLVREAEAKTRESSRLLHIVRA
NLREFSDKKLRVQEEQNLTSVLIAKERRSLGAATARAKAAQSALGQLERHRDELLWWTAK
IRRHVDDLVMQMSKRRALDLVYRAEDHAAELQRLAGALDSGFGNVRHVSLNATSATHIHS
NIRSLIEESEKLAKDALRAVTEFPEPLVSNGKAALQHSSTFLKEGKSLSRKHQGITLELR
ELKTMASTFQENADKITRQTNESLLILRAIPEGIRDSGTRIKELALSANQSAASTLKNVV
GLSQKLLNTSTDVSKVNSTLREANELLRDSSMTSLLAGRKVKDVETQANLLFDRLKPLKI
LEENLSRNLSEIKLLISQARKQAASIKVAVSSDRDCIRAYQPPISSTNYNTLTLNVKTSE
PDNLLFYLGSSTSSDFLAVEMRRGKVAFLWDMGSGSTRLEFPDFPINDNKWHSIYITRFG
NIGSLTVKEMSATQKPPPKTSKSLGAANVLDINNSTLMFVGGLGGQVKKSPAVKVTHFKG
CMGEAFLNGQSIGLWNYIEREGKCHGCFGSPQNEDSSFHFDGSGYSVVEKTLRATVTHII
MLFSTFSPNGLLLYLASNGTKDFLSIELIHGRVKVTIDLGSGPLALVTDRRYNNGTWYKI
AFQRNRKQGLLAVTDAYNTSYKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVT
SKSYVGCIRHLEISRSTFDLLRNSYGVRKGCMLEPIRSVSFLKGGYIELPPKSLSPESEL
LATFATTNSSGVILAALGKRGGNWQAHGSFQPFFSVMLTEGHIEVHVNLGDGTSLRRALL
HAPTGTFGDGQEHSISLIRSGRIITIQLDETKPVEMNLGPSVESMTINVSNLYIGGIPEG
EGAAMLKMRSFHGCIRNLIFNMELLDFTDAVGYEHVDLDTCLLSERPKLALHGEDSEPPP
EPHPLPSPQQCVVDGAPEFVPNAHQFGLTQSSHFVLPFNQLAVRKRLSVQLSIRTFASSG
LIFYMAHQNQVDYAILQLHWGHLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYFKRKGF
MTVDGQESPMVNIVGDGTTLDVEGKLYLGGLPSDYRSRNIGNITHSIPACIGEVTVNSKQ
LDKDSPVSAFAVAQCYAEAQEGTFFEGSGYAALVKEGYKVRSDVNITLEFRTSSENGVLL
GISSAKVDAIGLEIVNGKLLFHVNNGAGRITATYEPKATSPLCDGKWHTLHANKSKHRVV
LVVDGNAVHAESPHVQSTSVDTNNPIYVGGYPADVKQNCLSSQTSFRGCLRKLTLIKGPH
VQSYDFSRAFDLQGVFPHSCPGTES
NT seq 9078 nt   +upstreamnt  +downstreamnt
atgttctgcaaacttgtggagcacgtgccaggccggcctgtgcggaacccgcagtgccgc
atctgtgatggccacagtgccaaccccaaagaacgccatccaatatcaaacgcgatagat
ggtaccaataactggtggcaaagtcccagtattcaaaatgggagagaatatcactgggtc
acaatcactctggacttaagacaggtctttcaggtcgcctacatcatcatcaaagctgct
aacgcccctcgaccgggaaactgggttttggagcattctctggatggcaccaggttcagt
ccctggcagtactatgccgttagcgacacggagtgtttgactcgttacaatataaccccg
agacgggggccacccacttacagggcggatgatgaagtgatctgcacctcgtattactct
aggctggtgccactggagcatggagagatccatacatcactaatcaatgggagacccagc
gctgatgatctttcccccaagttgttggaatttacttctgcacgatacatccgccttcgc
ttacaacgcattcgaaccctcaatgcggatcttatgaccctcagccaccgtgacccgaag
gaccttgatcccattgttacaagacgatattactattcaatcaaagacatttctgttgga
ggaatgtgtatttgttatggccatgccagtagctgcccatgggatgaaactacaaagaaa
ctacggtgtcaatgcgaacataacacctgtggggagagctgcagtagatgttgtcctggg
taccatcaacagccctggagacccgggaccatttcttccggtaacatgtgtgaagaatgt
aattgccacaaaaaagcgaaagactgttattatgatgacagtgttgcaaatcagaagaaa
agtttgaatactgctggacagtatagaggaggaggggtttgcataaattgcctgcagaac
accatgggaatcaattgtgaaacctgcatcgatggatattatagaccacacaacgtgtct
ccgtatgaagacaacccttgccatccctgtgactgtaaccctttgggatccctcagttct
gtctgtattaaggatgatctccattctgatttacacaaaggaaaatggccaggtcagtgt
ccatgcaggggaggctacacaggacaaaaatgtgatcgctgccaatttggctacaggggt
tacccagcctgcgtcccctgtgactgcagtccagctggcagcgtgaacgaggacccgtgc
tcagagccttgtctctgtaaggaaaatgttgagggggaaaactgtgatcgctgcaagcca
ggattttataacttgaaggaaagaaacccccagggctgctctgagtgtttctgctttggc
gtttccgatgtctgcgacagtctttcttggcccatcagtcaggtgaaagatatgtccggg
tggctggtcaccgacttgatcagtccgaataagatcccatctcagcaggacgcactgggt
gggcgccatcagatcagcgtcaacaacaccgcggccatgcagcggctcacttccaagtat
tactggtcagcgccgaaggcctacctcggaaataagctgaccgcattcgggggattcctg
aagtacacggtgtcttatgaatttccagtggagacagtggacagtgccctcgtgtcttat
gctgacgttatcattaagggaaatggtctcactttaagcacccaggctgagggcctgtca
ttgcagccctacgaggagtacttcaacgtggttaggcttgtgcctgagaacttccgagac
tttaataacaaaagggagatagatcgagatcagctgctgacggtccttgccaatgtgaca
catcttttgatcagagccaactacaattctgcgaaaatggctctttacaggttggattct
gtctctctggacacagccagccctaacgttatagacctggcactggccaccgaagtggag
cactgcgaatgtccccaaggctatgcagggatctcctgtgagtcctgcctctctggctat
taccgcctggacggaatactcttcggaggaatttgtcaaccctgtgaatgccatggccat
gcagctgagtgtgatattcaaggcacttgttttgcatgcgaacacaacaccaccggggac
cactgtgagcagtgcctgcccggcttttacgggcgacctacccaagggactcctggggac
tgccagccttgcgcctgccccctctcctcagcctccaacaatttcagccccacctgccac
ctagatgctggagatgaagtggtctgtgaccagtgtgccctgggatactcaggaacttgg
tgcgagagatgtgcagacggttactatggaaacccaacagtgcctggggaatcctgtgtt
ccctgtaactgcagtgggaatgttgaccccttggaggccggtcactgtgactctgtcact
ggagaatgcctgaggtgcattgggaacacggatggcgcccactgtgagaggtgtgctgac
gggttctacggggatgctgtgactgccaaaaattgccgagcctgtgaatgccatggaaag
ggctctctctccgacgtctgccatccaaagactgggctgtgtgactgcagagcacatgtg
accggacagcagtgtgaccagtgcttgcatggctattacgggttggacacggggctcggc
tgcctgccctgtgactgcagcccgggctccatgtcagacgactgcgctgaggaaggccag
tgtcgctgcgtaccaggggtcaccgggaaaaggtgcgaccggtgtgcgcgtggcttctat
gcattccaggatggtggctgtaaaccctgtgactgcgctcacactcagaatacatgtgac
ccagaatcgggggagtgtgtctgccctcctcacacgcgaggtgtcacctgtgaagaatgt
gaggacggatactggggctatgacctggagctcggatgccaggcctgcaattgcagtagt
gcaggatcagccagtcgtcactgcgatgagcgcactggccattgccagtgtaagcccata
tttggtggaccgagctgcgatcagtgctccctgggtttcagagactttccagactgtgtg
gcctgtgactgtgacctgagagggaccttggaggacacctgtgatgaggaacagggtctt
tgcagctgtgcacaagaaactggtacctgctcttgcaaggaaaatgtccttggccttcag
tgcagtgagtgtcgcgtcggcacctacgctctccacgctgacaaccctcgggggtgcacc
ccgtgcttctgctttgggctgtcccagctctgcttagagctggagggttatgtgaggatg
ccaataacgctgggctcagatcagcctcttctgcgagtcgtttctcagagtaacctcagg
ggcacgacccatggggtgtactaccaggcccctgatgtcctcctagacgccgtgacagtc
aggaagcacgtccatgcagagccattttactggcggctgccagggcagttccagggagac
cagctcatggcctatggtggcaaactgaagtacagcgtggccttctattcctccaatggc
atgggaaccttcaaccttgagcctcaagtacttgtcagaggaggccggaccagaaagcaa
gtcatttacatggatgcacccgcaccagagaatggagtgagacaagagcaagaagtggaa
atgaaagagaattattggaaatattttaattctgtttctgaaaaacctgtcacacgctca
gattttatgtctgttcttagcaacatcgagtacattctcatcaaagcatcttacggtcaa
gggctacagcaaagcaggatctccaacatttccatggagatcggcaggaaggctgacgag
ctgcacccggggagggaggcagcctccctgttagagaagtgcgtctgccctcctggcacg
gctggactctcatgccaggactgcgcacctggttactacagagggaagcttccagaaggt
ggtgacagggaacttcggcttcttcttgctccttgtgtgccctgtagttgtaacaaccac
agtgacacctgtgaccctgaaacggggaagtgtctgaactgcagcgataacacctctgga
gaccactgtgatgtgtgtgctcccgggtactacgggaaggtgactggctcagccaccgac
tgctctctgtgcacctgtcctcacggccgccctgccagttttagtcccacgtgtgtcctg
gaaggtgacggcgatttccgctgtgatgcctgcgttccgggccatgaaggccagtattgt
gagaggtgctcctcaggttatcacgggaaccctcgagtgccaggtggcacctgccagagc
tgtgactgcagcccgcgtggctccgttcaccgtgactgtgaccgcgggtcggggcagtgc
gtctgcaggccaggggccgcggggctccggtgcgagcaatgtgagcccaggcacgtgctg
gtggagagcaactgtatagcttgtgatgacgaatgtgtaggtgtgctgctgaatgactta
gacagtgttggcgataccattcattctgtgaacctcaccagcattatccgtgttccacat
ggaattttgtcaaacctggaaaatacaactaaagatctccgggaatctttattaaaagga
gatataggaaaggaacttctagaatttcaacttgaaggtgttacagaacaaagagatgac
ctgcaaagggagctcactagagtgttaacaagtagccagcaggtggccagggctacggag
agaatcctcagcaagagtcaagatctcacaacatttactgagaagctgaagataagcatt
gaagaaattattgaaaaagcaacaactctaaatcagaccttgggtgaagatttccagcta
cccagttctactcttcacattatgcaaaagaacatgacatctttgttggaaaccatacag
aagaggcatttcatgcagctgcatcaaaatgccaccattgaactgaagactgctgaaaat
ttattgtcacaaattcagaaaaattaccggaagccacaggaagagtcaaaggtaataaaa
gaagcagcaagcagcctcctttcaaaacacaaccgtgaactgcaggcagcagaagacctc
gtgagggaggcagaggcgaagactcgggaaagcagccgcctcctgcacattgtccgtgcc
aacctgcgagagttcagtgataaaaagctgcgtgttcaagaagaacagaacttgacctcg
gtgctaatcgccaaagaaagaagatcgctgggtgccgccactgcacgtgcaaaggctgct
caaagtgctctagggcaattagagcgtcaccgggatgagctactttggtggactgccaaa
atcaggcgccatgtggatgatctggtcatgcagatgtccaaacggagagcgcttgacctt
gtctacagagctgaggaccacgcagctgagctccagagactagcaggcgctctggacagt
ggctttggaaacgttagacatgtgtccctgaatgcaaccagcgcaacccacatccattcc
aacattcggagcctgattgaagaatcagaaaaattggcaaaagatgctctcagggctgtg
actgagttcccagaaccgctggtgtctaatgggaaagcagctctccaacacagttccacg
tttctaaaagaaggcaagagcctgagcagaaagcaccaaggtatcacattggaactgaga
gaattgaaaactatggcaagcacatttcaagaaaatgctgataaaattactaggcagacc
aatgaatcactcctaatacttagagcaattccggaaggtatcagagacagtggaaccaga
atcaaagaattggccctatctgccaaccagagtgctgcgagcacactgaagaacgttgtg
ggattgagtcagaagctgttgaacacatcgacggatgtgtccaaggtcaattccacctta
cgagaagcaaacgaacttctacgggactcctcaatgaccagtctgttagctggaagaaaa
gttaaagatgtggaaacacaagccaaccttttatttgatcggttgaagcctttgaagata
ttagaagagaacctgagcagaaacctgtcagaaattaaactgctgatcagccaggcccgg
aaacaagcagcttctattaaagttgccgtgtcttcagacagagattgtatccgggcctac
cagcctcctatctcttcaactaactataacaccttaacactaaatgttaagacgagtgaa
cccgataaccttctcttctaccttggtagcagcactagctctgacttcctggcagtggag
atgcggcgggggaaagtggccttcctctgggatatgggctccgggtcaacgcggttggaa
ttcccagacttcccgatcaatgacaacaaatggcacagtatctacataaccagatttgga
aacattggttcattgactgtaaaggaaatgagcgcaactcagaagccaccaccaaaaaca
agtaaatccctaggagcagctaacgttctagatataaacaactcaacactgatgtttgtt
ggagggcttggaggacaagtcaagaagtctcctgctgtgaaggttactcatttcaaaggc
tgcatgggagaagccttcttgaatggacagtcgatcggcctgtggaactatattgaaagg
gagggcaagtgccatggctgctttggaagcccccagaatgaagactcgtcctttcatttt
gatgggagcgggtattctgtcgtagagaagacgctccgggctactgtgacgcacataatt
atgctttttagtaccttttcacctaacgggcttcttctctacctcgcttcaaatggcacc
aaagactttttatccattgagctgatccatggcagagttaaagttacaattgacttgggc
tcaggacctcttgcccttgtcacagaccgacgctataacaatggaacctggtacaaaatc
gccttccaacgaaaccggaagcaaggactcctagcagttactgatgcttataacaccagt
tataaggagaccaaacaaggtgaaaccccaggagcatcttctgacctcaatcgtctcgat
aaggatccaatttatgtgggtggattacctaggtcaagagttgtaaggagaggtgtcacc
agcaaaagctacgtaggctgtatcagacacctggaaatatccagatcgacctttgattta
ctcagaaattcctatggagtgagaaaaggctgtatgctggagcctatccggagtgttagc
ttcttgaaaggcggctacattgagttgccacccaagtctttgtcaccagaatcggaactg
ttggcaacatttgccaccacgaacagcagtggcgtcatcctggccgccctgggcaagcgc
ggggggaactggcaggcccatgggtctttccagcccttcttttccgtcatgctgactgaa
ggccacattgaagtgcatgttaatttgggggatgggacaagcctgagaagagctctcctg
catgcgcccacaggcacatttggcgacggacaagagcattctatctccttgataaggagc
gggagaattatcaccatccaactggatgagacaaagcctgtagaaatgaacttgggccca
tcagtggaaagcatgacaataaatgtatccaacctgtacataggagggattccagagggt
gagggggcagcgatgctcaagatgagatcatttcatggctgtatcagaaacctcatcttt
aacatggaacttttggatttcactgatgccgttggctatgaacacgtggacttggacacc
tgcttgctttcagaacggcctaagctggctcttcatggagaggacagtgagcccccgcca
gagccacatcctttaccaagtccgcaacagtgtgtcgtggatggagccccagaatttgtc
cccaacgctcaccagtttggcctcacacaaagcagccatttcgtgctgcctttcaatcag
ttggctgtcagaaagaggctctcggtgcagctaagtatccgcacatttgcctccagtggg
ctgatcttctacatggctcaccagaaccaagtggattacgccatactccagctgcactgg
ggccacctccacttcatgtttgaccttggcaaaggaagaacaaaagtgtctcaccctgcg
ctgctcagtgatggcaagtggcacacggtcaagacggagtactttaaaagaaagggcttc
atgactgttgatggtcaggagtcccccatggtgaatatagtgggagatggcaccacgttg
gatgtggaagggaagttgtacctaggaggccttccctctgattacaggtccaggaacatt
ggaaatatcacccacagcatccccgcttgcattggggaggtgacagtgaacagcaagcag
ctggacaaggacagccccgtgtctgcatttgcagtggcccagtgctatgcggaggcccaa
gaaggaactttctttgaaggaagtggttatgcagctcttgtcaaagaaggctacaaagtt
cgctcagatgtaaacatcacacttgagtttcgtacctcctcagagaacggcgtcctcctt
gggatcagcagtgccaaagtggatgccatcggcttagagattgtgaatggcaagctcttg
tttcatgttaacaatggtgctggtaggataacagccacatacgagcccaaagctaccagt
cctctctgcgatggaaagtggcacacactgcatgctaacaaaagcaagcaccgcgtggtg
ctggtcgtcgatgggaacgccgtgcatgctgaaagtccacacgtccagtccacttcggtg
gacaccaacaatcccatttatgtcggtggataccctgctgatgtaaagcaaaactgcctg
agcagccagacttccttccgggggtgtttgagaaagctcactctgatcaagggcccacac
gtacaatcctatgacttcagcagagcttttgacctacaaggagttttccctcattcctgt
cctgggactgaatcctga

DBGET integrated database retrieval system