KEGG   Miniopterus natalensis: 107531104
Entry
107531104         CDS       T05883                                 

Gene name
ICAM2
Definition
(RefSeq) intercellular adhesion molecule 2
  KO
K06523  intercellular adhesion molecule 2
Organism
mna  Miniopterus natalensis
Pathway
mna04514  Cell adhesion molecules
mna04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107531104 (ICAM2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107531104 (ICAM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107531104 (ICAM2)
   04091 Lectins [BR:mna04091]
    107531104 (ICAM2)
CD molecules [BR:mna04090]
 Proteins
  107531104 (ICAM2)
Lectins [BR:mna04091]
 I-type lectins (Siglecs)
  107531104 (ICAM2)
SSDB
Motif
Pfam: ICAM_N DuoxA DUF4231
Other DBs
NCBI-GeneID: 107531104
NCBI-ProteinID: XP_016060583
LinkDB
Position
Unknown
AA seq 279 aa
MPFEMSPFCCWRLSAVLLALLVCLGSGGNAFEVYSWPEQLVVEHGGSYEINCSTSCPCPD
LGGVETVLNKTLLDKQPQWMQFRFFDASNDTELQCHFTCSGEQQSAVVRVSVFRPPEQVL
LKLQPMWVTVGKSFIIECRVPTVAPLETLTLTLLRGKEPLHMQAFGRATAVPGEAMITYN
RTAHKEDGRHNFSCQAELDLRSRGGGIIRRTSEPQVLDIYEPGQDNQMVIIITVVSVLLF
LFVTSVLLCFVFGQQWHQRRRGNYGVQAAWSRLRRVYRA
NT seq 840 nt   +upstreamnt  +downstreamnt
atgccatttgagatgtcccccttctgttgctggcgcctgtctgcggttcttcttgccctg
ctcgtctgcctagggtctggcgggaacgcattcgaggtatactcgtggccagagcagctg
gtggtggagcacggagggtcctatgagatcaactgtagtaccagctgtccctgcccagat
cttggtggcgtggagaccgtcctaaacaagactctgctggacaaacagcctcagtggatg
cagttcaggttcttcgatgcctccaacgacacggagctgcagtgccacttcacctgctct
ggggagcagcagtccgcggtggtcagagtcagtgtgttccgccccccagagcaagtgctg
ctgaagctgcagcccatgtgggtgactgtaggcaaatctttcatcattgagtgcagagtg
cccactgtggccccccttgagacactcaccctcaccctgctccgtggcaaggagcccctg
cacatgcaggccttcgggagggcaacggctgtcccaggagaggccatgatcacatacaac
agaacggctcacaaggaagacggtcgccacaacttctcctgccaggccgagctggacctg
cggtctcgtggtgggggcatcattcgcagaacctcagagccccaggtgcttgatatctat
gaacccgggcaggacaaccagatggtcatcatcatcacagtcgtgtcagtgctgctgttc
ctgtttgtgacatccgtcttgctgtgctttgtcttcggccagcagtggcaccagaggcga
agaggcaactacggggtgcaggcagcttggagtagactgaggcgggtctaccgggcatag

DBGET integrated database retrieval system